Asymmetric Unit
Chain A from PDB Type:PROTEIN Length:125
SCOP domains d8choa_ A: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI SCOP domains
CATH domains 8choA00 A:1-125 [code=3.10.450.50, no name defined] CATH domains
Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
Sec.struct. author ...hhhhhhhhhhhhhhhhh..hhhhhhh.....eee..........hhhhhhhhhhhhh...eeee....eee..eeeeeeeeeeee..eeeee..eeeeee.....eeeeeee..hhheee.. Sec.struct. author
SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
8cho A 1 MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA 125
10 20 30 40 50 60 70 80 90 100 110 120
Legend: |
|
→ Mismatch |
(orange background) |
|
- |
→ Gap |
(green background, '-', border residues have a numbering label) |
|
|
→ Modified Residue |
(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name) |
|
x |
→ Chemical Group |
(purple background, 'x', labelled with number + name, e.g. ACE or NH2) |
|
extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|' |
|