Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CHAETOMIUM THERMOPHILUM UTP10 MIDDLE DOMAIN
 
Authors :  R. Chen, X. Zhu, K. Ye
Date :  10 Jan 17  (Deposition) - 28 Jun 17  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nucleolar Protein, Components Of 90S Preribosome, Ribosomal Protein, Nuclear Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Q. Sun, X. Zhu, J. Qi, W. An, P. Lan, D. Tan, R. Chen, B. Wang, S. Zheng, C. Zhang, X. Chen, W. Zhang, J. Chen, M. Q. Dong, K. Ye
Molecular Architecture Of The 90S Small Subunit Pre-Ribosom
Elife V. 6 2017
PubMed-ID: 28244370  |  Reference-DOI: 10.7554/ELIFE.22086

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 472-872
    Gene: CTHT_0024640
    Organism Scientific: CHAETOMIUM THERMOPHILUM VAR. THERMOPHILUM DSM 1495
    Organism Taxid: 759272
    Strain: DSM 1495
    Synonym: UTP10

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5WY3)

(-) Sites  (0, 0)

(no "Site" information available for 5WY3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5WY3)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Arg A:72 -Pro A:73
2Ala A:75 -Pro A:76
3Ser B:17 -Leu B:18
4Ala B:75 -Pro B:76

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5WY3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5WY3)

(-) Exons   (0, 0)

(no "Exon" information available for 5WY3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:363
                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhhhhhhhh............hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh...ee..eehhhhhhhhhhhhhh.hhhhhhhhhhhhh.hhhhhhhhhhh.....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5wy3 A  16 PSLDSTFERLSKLQPTATSCLAKDSESLFNDLCSVFLSAAVSESDLERFDATPVLSRPKAPSNSFYLSFYLRVWCGPYPTLAKVAALERVKTRLKEGDCVDKDFQAIFPYCIAALSDPAKKVRRAAADLVAVLGSALWAAKDLYGKTGTTSPLDKDALKALIRSVLIPCLEESVLHEDHVVAALVGALESHSARLSIFKFLCGHVVETPLLAVKLRLLRSLNQIRRISGTTRTDLLLPLLRWWAGLSANEAAELAAQESVDVPAIDDAVVDVVVPNHAAGLEAFFQLVKEAIRPGLLQAIFARIAKMWPSMKSDTKYSTAKTLFELTQDPKLNAEQSDVITEAVEVLRKVDLTTDILHYFIDS 402
                                    25        35        45        55        65        75        85        95       105       115       125       135       145     ||164       174       184       194       204       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399   
                                                                                                                                                                 151|                                                 213|                                                                                                                                                                             
                                                                                                                                                                  161                                                  229                                                                                                                                                                             


Chain B from PDB  Type:PROTEIN  Length:366
                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhhhhhhhhh............hhhhhhhhhh....hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh...ee..eehhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5wy3 B  17 SLDSTFERLSKLQPTATSCLAKDSESLFNDLCSVFLSAAVSESDLERFDATPVLSRPKAPSNSFYLSFYLRVWCGPYPTLAKVAALERVKTRLKEGDCVDKDFQAIFPYCIAALSDPAKKVRRAAADLVAVLGSAYKQLWAAKDLYGKTGTTSPLDKDALKALIRSVLIPCLEESVLHEDHVVAALVGALELSHSARLSIFKFLCGHVVETPLLAVKLRLLRSLNQIRRISGTTRTDLLLPLLRWWAGLSANEAAELAAQESVDVPAIDDAVVDVVVPNHAAGLEAFFQLVKEAIRPGLLQAIFARIAKMWPSMKSDTKYSTAKTLFELTQDPKLNAEQSDVITEAVEVLRKVDLTTDILHYFIDS 402
                                    26        36        46        56        66        76        86        96       106       116       126       136       146      |162       172       182       192       202       212||     236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396      
                                                                                                                                                                  153|                                                  213|                                                                                                                                                                              
                                                                                                                                                                   160                                                   228
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5WY3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5WY3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5WY3)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5WY3)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5wy3)
 
  Sites
(no "Sites" information available for 5wy3)
 
  Cis Peptide Bonds
    Ala A:75 - Pro A:76   [ RasMol ]  
    Ala B:75 - Pro B:76   [ RasMol ]  
    Arg A:72 - Pro A:73   [ RasMol ]  
    Ser B:17 - Leu B:18   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5wy3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G0S5L1_CHATD | G0S5L1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G0S5L1_CHATD | G0S5L1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        G0S5L1_CHATD | G0S5L1: 5wyl
UniProtKB/TrEMBL
        G0S5L1_CHATD | G0S5L1: 5jpq

(-) Related Entries Specified in the PDB File

5wy4