5UGC - JenaLib

Title :   CRYSTAL STRUCTURE OF THE EGFR KINASE DOMAIN (L858R, T790M, V948R) IN COMPLEX WITH A COVALENT INHIBITOR N-[(3R,4R)-4-FLUORO-1-{6-[(3-METHOXY-1-METHYL-1H-PYRAZOL-4-YL)AMINO]-9-METHYL-9H-PURIN-2-YL}PYRROLIDIN-3-YL]PROPANAMIDE

Authors :   K. S. Gajiwala, R. A. Ferre

Date :   08 Jan 17 (Deposition) - 22 Mar 17 (Release) - 26 Apr 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.58

Chains :   Asym./Biol. Unit : A

Keywords :   Kinase, Covalent Inhibitor, Lung Cancer, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Planken, D. C. Behenna, S. K. Nair, T. O. Johnson, A. Nagata, C. Almaden, S. Bailey, T. E. Ballard, L. Bernier, H. Cheng, S. Cho-Schultz, D. Dalvie, J. G. Deal, D. M. Dinh, M. P. Edwards, R. A. Ferre, K. S. Gajiwala, M. Hemkens, R. S. Kania, J. C. Kath, J. Matthews, B. W. Murray, S. Niessen, S. T. Orr, M. Pairish, N. W. Sach, H. Shen, M. Shi, J. Solowiej, K. Tran, E. Tseng, P. Vicini, Y. Wang, S. L. Weinrich, R. Zhou, M. Zientek, L. Liu, Y. Luo, S. Xin, C. Zhang, J. Lafontaine
Discovery Of N-((3R, 4R)-4-Fluoro-1-(6-((3-Methoxy-1-Methyl-1H-Pyrazol-4- L)Amino)-9-Methyl-9H-Purin-2-Yl)Pyrrolidine-3-Yl)Acrylamide (Pf-06747775) Through Structure-Based Drug Design: A High Affinity Irreversible Inhibitor Targeting Oncogenic Egfr Mutants With Selectivity Over Wild-Type Egfr.
J. Med. Chem. V. 60 3002 2017
PubMed-ID: 28287730 | Reference-DOI: 10.1021/ACS.JMEDCHEM.6B01894

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 7)

Sites (7, 7)

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:718 , GLY A:719 , ALA A:743 , GLN A:791 , MET A:793 , PRO A:794 , GLY A:796 , CYS A:797 , ASP A:800 , ARG A:841 , LEU A:844 , PHE A:856 , HOH A:9151 , HOH A:9203 , HOH A:9231	binding site for residue 8BS A 9001
2	AC2	SOFTWARE	ARG A:836 , TYR A:869 , ALA A:871 , GLU A:872 , GLY A:873 , GLY A:874 , HOH A:9180	binding site for residue SO4 A 9002
3	AC3	SOFTWARE	ARG A:803 , LYS A:913 , GLU A:963 , HOH A:9167 , HOH A:9187	binding site for residue SO4 A 9003
4	AC4	SOFTWARE	LYS A:806 , THR A:909 , PHE A:910 , PRO A:937 , ARG A:948 , HOH A:9135 , HOH A:9144	binding site for residue GOL A 9004
5	AC5	SOFTWARE	ARG A:932 , PRO A:937 , ILE A:938 , ARG A:948 , TRP A:951 , HOH A:9135 , HOH A:9247	binding site for residue GOL A 9005
6	AC6	SOFTWARE	ASP A:916 , PRO A:937 , CYS A:939 , MET A:952 , SER A:957 , HOH A:9103 , HOH A:9127	binding site for residue GOL A 9006
7	AC7	SOFTWARE	ASP A:837 , ARG A:841 , ASN A:842 , PHE A:856	binding site for residue EDO A 9007

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:280
                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.hhh.eeeeeeeee...eeeeeeee........eeeeeeee...hhhhhhhhhhhhhh........eeeeee...eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee.......ee......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ugc A 702 ALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDE 985
                                   711       721       731       741      |755       765       775       785       795       805       815       825       835       845       855       865       875       885       895       905       915       925       935       945       955       965       975       985
                                                                        748|                                                                                                                                                                                                                                        
                                                                         753

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (111, 111)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		8BS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:984 - Glu A:985	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5ugc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	EGFR_HUMAN \| P00533
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description