Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THERMUS PHAGE P74-26 LARGE TERMINASE NUCLEASE DOMAIN
 
Authors :  B. J. Hilbert, J. A. Hayes, N. P. Stone, B. A. Kelch
Date :  27 Sep 16  (Deposition) - 25 Jan 17  (Release) - 03 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A
Keywords :  Nuclease, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. J. Hilbert, J. A. Hayes, N. P. Stone, R. G. Xu, B. A. Kelch
The Large Terminase Dna Packaging Motor Grips Dna With Its Atpase Domain For Cleavage By The Flexible Nuclease Domain.
Nucleic Acids Res. V. 45 3591 2017
PubMed-ID: 28082398  |  Reference-DOI: 10.1093/NAR/GKW1356

(-) Compounds

Molecule 1 - PHAGE TERMINASE LARGE SUBUNIT
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28
    Expression System StrainBLR-DE3
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 257-485
    GeneP74P84
    Organism ScientificTHERMUS PHAGE P7426
    Organism Taxid466052

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5TGE)

(-) Sites  (0, 0)

(no "Site" information available for 5TGE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5TGE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5TGE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TGE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TGE)

(-) Exons   (0, 0)

(no "Exon" information available for 5TGE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:190
                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhheee..eee..eee.........eeeeee......eeeeeeee....eeeeeeeee..hhhhhhhhhhhhhhh....eeee.......hhhhhhh..eee....hhhhhhhhhhhhhhhhhh...eee.hhhhhhhhhheeeee.....eeeee.....hhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tge A 257 NSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIVCLERMNGATWSDQVARLKALSEDYGHAYVVADTWDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYEGKDGYKF 449
                                   266       276       286       296       306       316       326       336       346  ||   359       369       379       389       399       409       419       429       439       449
                                                                                                                      349|                                                                                                
                                                                                                                       353                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TGE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TGE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TGE)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5TGE)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5tge)
 
  Sites
(no "Sites" information available for 5tge)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5tge)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5tge
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A7XXR1_9CAUD | A7XXR1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A7XXR1_9CAUD | A7XXR1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A7XXR1_9CAUD | A7XXR14zni 4znj 4znk 4znl 5m1f

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5TGE)