5SYM - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   COCRYSTAL STRUCTURE OF THE HUMAN ACYL PROTEIN THIOESTERASE 1 WITH AN ISOFORM-SELECTIVE INHIBITOR, ML348

Authors :   J. A. Stuckey, K. J. Labby, J. L. Meagher, S. J. Won, B. R. Martin

Date :   11 Aug 16 (Deposition) - 26 Oct 16 (Release) - 28 Dec 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.55

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Hydrolase, Inhibitor, Thioesterase, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. J. Won, D. Davda, K. J. Labby, S. Y. Hwang, R. Pricer, J. D. Majmudar, K. A. Armacost, L. A. Rodriguez, C. L. Rodriguez, F. S. Chong, K. A. Torossian, J. Palakurthi, E. S. Hur, J. L. Meagher, C. L. Brooks, J. A. Stuckey, B. R. Martin
Molecular Mechanism For Isoform-Selective Inhibition Of Acy Protein Thioesterases 1 And 2 (Apt1 And Apt2).
Acs Chem. Biol. V. 11 3374 2016
PubMed-ID: 27748579 | Reference-DOI: 10.1021/ACSCHEMBIO.6B00720

Molecule 1 - ACYL-PROTEIN THIOESTERASE 1
	Chains	:	A, B
	EC Number	:	3.1.2.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	LYPLA1, APT1, LPL1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HAPT1,LYSOPHOSPHOLIPASE 1,LYSOPHOSPHOLIPASE I,LYSOPLA I

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 13)

No.	Name	Count	Type	Full Name
1	71Q	2	Ligand/Ion	N-[2-CHLORO-5-(TRIFLUOROMETHYL)PHENYL]-2-[4-(FURAN-2-CARBONYL)PIPERAZIN-1-YL]ACETAMIDE
2	CL	4	Ligand/Ion	CHLORIDE ION
3	EDO	7	Ligand/Ion	1,2-ETHANEDIOL

Biological Unit 1 (2, 7)

No.	Name	Count	Type	Full Name
1	71Q	1	Ligand/Ion	N-[2-CHLORO-5-(TRIFLUOROMETHYL)PHENYL]-2-[4-(FURAN-2-CARBONYL)PIPERAZIN-1-YL]ACETAMIDE
2	CL	-1	Ligand/Ion	CHLORIDE ION
3	EDO	6	Ligand/Ion	1,2-ETHANEDIOL

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	71Q	1	Ligand/Ion	N-[2-CHLORO-5-(TRIFLUOROMETHYL)PHENYL]-2-[4-(FURAN-2-CARBONYL)PIPERAZIN-1-YL]ACETAMIDE
2	CL	-1	Ligand/Ion	CHLORIDE ION
3	EDO	1	Ligand/Ion	1,2-ETHANEDIOL

Asymmetric Unit (13, 13)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ILE A:75 , GLY A:77 , LEU A:78 , SER A:79 , PRO A:80 , TRP A:145 , LEU A:146 , ARG A:149 , LEU A:176 , VAL A:177 , PHE A:181 , THR A:185 , CL A:308 , HOH A:431 , HOH A:456	binding site for residue 71Q A 301
02	AC2	SOFTWARE	GLY A:36 , TRP A:37 , SER A:210 , MET B:65	binding site for residue EDO A 302
03	AC3	SOFTWARE	SER A:210 , CYS A:211 , MET A:215 , HOH A:531	binding site for residue EDO A 303
04	AC4	SOFTWARE	LYS A:97 , THR A:131 , THR A:132 , GLN A:133 , HOH A:403 , HOH A:423 , GLU B:204 , GLN B:213	binding site for residue EDO A 304
05	AC5	SOFTWARE	LYS A:19 , ALA A:20 , ASN A:106 , CL A:307 , HOH A:428 , ARG B:45	binding site for residue EDO A 305
06	AC6	SOFTWARE	GLN A:83 , GLU A:84 , HOH A:459	binding site for residue EDO A 306
07	AC7	SOFTWARE	ALA A:20 , EDO A:305 , ARG B:45 , HOH B:547	binding site for residue CL A 307
08	AC8	SOFTWARE	LEU A:30 , SER A:119 , GLN A:120 , 71Q A:301 , HOH B:414	binding site for residue CL A 308
09	AC9	SOFTWARE	ARG A:18 , THR A:21 , PRO A:228 , ILE A:229	binding site for residue CL A 309
10	AD1	SOFTWARE	MET A:65 , HOH A:466 , GLY B:36 , TRP B:37 , SER B:210	binding site for residue EDO A 310
11	AD2	SOFTWARE	LEU B:30 , ILE B:75 , GLY B:77 , LEU B:78 , SER B:79 , PRO B:80 , TRP B:145 , LEU B:146 , ARG B:149 , LEU B:176 , VAL B:177 , PHE B:181 , THR B:185 , CL B:303 , HOH B:408 , HOH B:411	binding site for residue 71Q B 301
12	AD3	SOFTWARE	ASN A:66 , GLY A:159 , MET B:207 , SER B:209 , HOH B:417 , HOH B:426 , HOH B:450	binding site for residue EDO B 302
13	AD4	SOFTWARE	HOH A:420 , LEU B:30 , SER B:119 , GLN B:120 , 71Q B:301	binding site for residue CL B 303

(no "SS Bond" information available for 5SYM)

Asymmetric Unit

No.	Residues
1	Thr A:8	-	Pro A:9

(no "SAP(SNP)/Variant" information available for 5SYM)

(no "PROSITE Motif" information available for 5SYM)

(no "Exon" information available for 5SYM)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.......eeeeee......hhhhhhhhhh.....eeeee....eee.hhhh..eee..............hhhhhhhhhhhhhhhhhhhhhh..hhh.eeeeeehhhhhhhhhhhh.......eeeee.....hhhhh............eeeeeee......hhhhhhhhhhhhhhhhhhh.eeeeee.......hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5sym A   8 TPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID 230
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Chain B from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.......eeeeee......hhhhhhhhhh.....eeeee....eee.hhhh..eee..............hhhhhhhhhhhhhhhhhhhhhh..hhh.eeeeeehhhhhhhhhhhhhh.....eeeee.....hhhhh............eeeeeee......hhhhhhhhhhhhhhhhhhh.eeeeee.......hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5sym B   8 TPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID 230
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 5SYM)

(no "CATH Domain" information available for 5SYM)

(no "Pfam Domain" information available for 5SYM)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		71Q	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Thr A:8 - Pro A:9	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	5sym
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LYPA1_HUMAN \| O75608
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LYPA1_HUMAN \| O75608
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LYPA1_HUMAN \| O75608	:	1fj2

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 13)

Sites (13, 13)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File