Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE HUMAN FE65-PTB2 HOMODIMER
 
Authors :  L. P. Feilen, K. Haubrich, I. Sinning, U. Konietzko, S. Kins, B. Simon, K
Date :  20 Apr 17  (Deposition) - 03 May 17  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Alzheimers Disease, Phosphotyrosine-Binding (Ptb) Domain, Signaling Protein, Homodimerization (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. P. Feilen, K. Haubrich, P. Strecker, S. Probst, S. Eggert, G. Stier, I. Sinning, U. Konietzko, S. Kins, B. Simon, K. Wild
Fe65-Ptb2 Dimerization Mimics Fe65-App Interaction.
Front Mol Neurosci V. 10 140 2017
PubMed-ID: 28553201  |  Reference-DOI: 10.3389/FNMOL.2017.00140

(-) Compounds

Molecule 1 - AMYLOID BETA A4 PRECURSOR PROTEIN-BINDING FAMILY B MEMBER 1
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: APBB1, FE65, RIR
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PROTEIN FE65

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric Unit (2, 11)
No.NameCountTypeFull Name
1GOL5Ligand/IonGLYCEROL
2SO46Ligand/IonSULFATE ION
Biological Unit 1 (2, 7)
No.NameCountTypeFull Name
1GOL3Ligand/IonGLYCEROL
2SO44Ligand/IonSULFATE ION
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2SO42Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:588 , ARG A:605 , ARG A:607 , ARG A:657 , SO4 A:703binding site for residue SO4 A 701
02AC2SOFTWAREARG A:607 , LYS A:660binding site for residue SO4 A 702
03AC3SOFTWAREARG A:657 , TYR A:658 , SO4 A:701 , ARG C:616 , VAL C:618binding site for residue SO4 A 703
04AC4SOFTWAREALA B:588 , ARG B:605 , ARG B:607 , HOH B:812binding site for residue SO4 B 701
05AC5SOFTWAREASN B:563 , GLY B:615 , ARG B:616 , ASP B:617binding site for residue GOL B 702
06AC6SOFTWAREPRO A:580 , HIS A:594 , ARG C:605 , ARG C:607 , ARG C:657 , HOH C:803binding site for residue SO4 C 701
07AC7SOFTWAREGLY B:558 , VAL B:559 , ASP B:560 , PHE B:611 , GLY C:558 , VAL C:559 , ASP C:560 , PHE C:611 , CYS D:661binding site for residue GOL C 702
08AC8SOFTWAREASN C:563 , LEU C:566 , GLU C:567 , GLY C:615 , ARG C:616 , ASP C:617binding site for residue GOL C 703
09AC9SOFTWARELEU C:539 , LEU D:539 , VAL D:540binding site for residue GOL C 704
10AD1SOFTWARELEU D:609 , SER D:610 , PHE D:611 , LEU D:612 , HOH D:806binding site for residue GOL D 702
11AD2SOFTWAREVAL B:618 , ARG D:605 , VAL D:606 , PHE D:608 , LEU D:609 , ARG D:657 , HOH D:803 , HOH D:810binding site for Di-peptide SO4 D 701 and ARG D 607

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:661 -D:661

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Glu A:640 -Pro A:641
2Glu B:640 -Pro B:641
3Glu C:640 -Pro C:641
4Glu D:640 -Pro D:641

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5NQH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5NQH)

(-) Exons   (0, 0)

(no "Exon" information available for 5NQH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee.....hhhhhhhhhhhhhh..hhhhheeeeeee...eeeeee.....eeeeee...eeeeee.....eeeeeee.....eeeeeeee...hhhhhhhhhhhhhh..eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5nqh A 539 LVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS 666
                                   548       558       568       578       588       598       608       618       628       638       648       658        


Chain B from PDB  Type:PROTEIN  Length:123
                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeee....hhhhhhhhhhhhhh...eeeeeee...eeeeee.....eeeeee...eeeeee.....eeeeeeee...eeeeeeeee...hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 5nqh B 539 LVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDAR 665
                                   548       558       568   ||  582       592       602       612       622       632       642       652       662   
                                                           572|                                                                                        
                                                            577                                                                                        


Chain C from PDB  Type:PROTEIN  Length:125
                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeee....hhhhhhhhhhhhhh.......eeeeeee...eeeeee.....eeeeee...eeeeee.....eeeeeee.....eeeeeeee...hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 5nqh C 539 LVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLD 663
                                   548       558       568       578       588       598       608       618       628       638       648       658     


Chain D from PDB  Type:PROTEIN  Length:125
                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeee....hhhhhhhhhhhhhh.....eeeeeee...eeeeee.....eeeeee...eeeeee.....eeeeee.....eeeeeee....hhhhhhhhhhhhhh..eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 5nqh D 539 LVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS 666
                                   548       558       568   ||  580       590       600       610       620      |631       641       651       661     
                                                           572|                                                 627|                                     
                                                            575                                                  629
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5NQH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5NQH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5NQH)

(-) Gene Ontology  (45, 45)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:640 - Pro A:641   [ RasMol ]  
    Glu B:640 - Pro B:641   [ RasMol ]  
    Glu C:640 - Pro C:641   [ RasMol ]  
    Glu D:640 - Pro D:641   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5nqh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  APBB1_HUMAN | O00213
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  APBB1_HUMAN | O00213
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        APBB1_HUMAN | O00213: 2e45 2ho2 2idh 2oei 3d8d 3d8e 3d8f 3dxc 3dxd 3dxe

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5NQH)