Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  GLYCOSIDE HYDROLASE BACCELL_00856
 
Authors :  J. Munoz-Munoz, A. Cartmell, N. Terrapon, B. Henrissat, H. J. Gilbert
Date :  16 Jan 17  (Deposition) - 26 Apr 17  (Release) - 17 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Rhamnosidase, Bacteroides, Beta-Propeller, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Munoz-Munoz, A. Cartmell, N. Terrapon, B. Henrissat, H. J. Gilbert
Unusual Active Site Location And Catalytic Apparatus In A Glycoside Hydrolase Family.
Proc. Natl. Acad. Sci. V. 114 4936 2017 U. S. A.
PubMed-ID: 28396425  |  Reference-DOI: 10.1073/PNAS.1701130114

(-) Compounds

Molecule 1 - BACCELL_00856
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: BACCELL_00856
    Organism Scientific: BACTEROIDES CELLULOSILYTICUS DSM 14838
    Organism Taxid: 537012

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5MVH)

(-) Sites  (0, 0)

(no "Site" information available for 5MVH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5MVH)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asn A:42 -Asn A:43
2Leu A:248 -Pro A:249

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MVH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MVH)

(-) Exons   (0, 0)

(no "Exon" information available for 5MVH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:397
                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...............eeee..eeeeeee....eeeeeeee......eeeeeeee.........eeeee.....eeeee........eee......................eeeeeeee.hhh.eeeeeee......eeeeeeee....eeeeee..........eeeeeeee.....eeeeeeee...hhh.eeeeeeeee........................eeee............eeee.....eeeeeee........eeeeeee....eeeee..................eeeee..eeeeee.hhhhh...eeeee.......eeeee.............hhhhhhhhh.eeeeee........eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mvh A  21 QQLVEVGNGYSQTSVNTTVFRNNSLVTQGDEQYISYYDGDGYLVLGKRKLDSDQWTLKRTQYKGNVKDAHNIISMMLDGEGYLHLSFDHHGHKLNYCRSTAPYTLELGDKEPMTGVDEGNVTYPEFYPLNGGDLLFVYRSGSSGRGNLVMNHYSVKEKKWNRVQDVLIDGEDQRNAYWQLYVDEQGTIHLSWVWRETWHVETNHDLCYARSYDNGVTWYKANGKKYDLPIRYNNAEYACRIPQNSELINQTSMSADASGNPYIATYWRDPDSEVPQYRIVWHDGQMWHNRQVSNRHTPFSLKMIPIARPRIVVDGGEIFYIFRDEERGSRVSLAHAAAVGVGKWTFTDLTNFPVDAWEPSHDTELWKQKRRLHLFVQHTKQEFAPQPVYVLEVVKPK 429
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320 ||    335       345       355       365       375       385       395       405||     422       
                                                                                                                                                                                                                                                                                                                                       322|                                                                           406|               
                                                                                                                                                                                                                                                                                                                                        328                                                                            414
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MVH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MVH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MVH)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5MVH)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5mvh)
 
  Sites
(no "Sites" information available for 5mvh)
 
  Cis Peptide Bonds
    Asn A:42 - Asn A:43   [ RasMol ]  
    Leu A:248 - Pro A:249   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mvh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  E2N9B1_9BACE | E2N9B1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  E2N9B1_9BACE | E2N9B1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5MVH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MVH)