Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  G307E VARIANT OF MURINE APOPTOSIS INDUCING FACTOR IN COMPLEX WITH NAD+
 
Authors :  L. Sorrentino, F. Cossu, A. Aliverti, M. Milani, E. Mastrangelo
Date :  29 Nov 16  (Deposition) - 12 Jul 17  (Release) - 12 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym./Biol. Unit :  A,C
Keywords :  Oxidoreductase, Apoptosis Inducing Factor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Sorrentino, F. Cossu, M. Milani, A. Aliverti, E. Mastrangelo
Structural Bases Of The Altered Catalytic Properties Of A Pathogenic Variant Of Apoptosis Inducing Factor.
Biochem. Biophys. Res. 2017 Commun.
PubMed-ID: 28666871  |  Reference-DOI: 10.1016/J.BBRC.2017.06.156

(-) Compounds

Molecule 1 - APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    Chains: A, C
    EC Number: 1.1.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: AIFM1, AIF, PDCD8
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: PROGRAMMED CELL DEATH PROTEIN 8

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:264 , GLU A:307 , GLY A:308 , PHE A:309 , LEU A:310 , GLU A:313 , PRO A:334 , ALA A:396 , VAL A:397 , GLY A:398 , GLU A:452 , HIS A:453 , TRP A:482 , FAD A:702 , HOH A:801 , HOH A:805 , HOH A:829binding site for residue NAD A 701
2AC2SOFTWAREGLY A:137 , GLY A:138 , GLY A:139 , THR A:140 , ALA A:141 , VAL A:161 , GLU A:163 , ASP A:164 , ARG A:171 , PRO A:172 , SER A:175 , VAL A:232 , ALA A:258 , THR A:259 , GLY A:260 , ARG A:284 , GLU A:313 , ASN A:402 , GLY A:436 , ASP A:437 , GLU A:452 , HIS A:453 , HIS A:454 , ALA A:457 , PHE A:481 , TRP A:482 , NAD A:701 , HOH A:806 , HOH A:810 , HOH A:814binding site for residue FAD A 702
3AC3SOFTWAREARG C:264 , GLU C:307 , PHE C:309 , LEU C:310 , GLU C:313 , LYS C:341 , ALA C:396 , VAL C:397 , GLY C:398 , GLU C:452 , HIS C:453 , TRP C:482 , FAD C:702 , HOH C:805 , HOH C:821 , HOH C:823 , HOH C:829binding site for residue NAD C 701
4AC4SOFTWAREGLY C:137 , GLY C:138 , GLY C:139 , THR C:140 , ALA C:141 , VAL C:161 , GLU C:163 , ASP C:164 , ARG C:171 , PRO C:172 , SER C:175 , VAL C:232 , ALA C:258 , THR C:259 , GLY C:260 , ARG C:284 , GLU C:313 , ASN C:402 , GLY C:436 , ASP C:437 , GLU C:452 , HIS C:453 , HIS C:454 , ALA C:457 , PHE C:481 , TRP C:482 , NAD C:701 , HOH C:801 , HOH C:805 , HOH C:807 , HOH C:827 , HOH C:830 , HOH C:836binding site for residue FAD C 702

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5MIV)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gln C:194 -Trp C:195

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MIV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MIV)

(-) Exons   (0, 0)

(no "Exon" information available for 5MIV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:442
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..hhhhhhhhhhhhhhh...eeeee.........hhhhhhhhhhh...hhhhhheee.....eee.....................eee......eeeee....eeee....eeeeeeeee...eee..hhhhhhhhhhhhh.eee..hhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhhhheee....eeeeee....eeeee....eeee.eeee...eee..hhhhhhh.........ee.....eee..eee....eeeee...eeee..hhhhhhhhhhhhhhhhh..........eeeee.....eeeeee.......eeeee...eee......eeeeeee..eeeeeeee....hhhhhhhhhhhh....hhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5miv A 128 PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGEGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKEITIPEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE 611
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507 ||   |559       569       579       589       599       609  
                                                                                                                                                                                                                                                                                                                                                                                                                       509| 543|                                                      
                                                                                                                                                                                                                                                                                                                                                                                                                        539  557                                                      


Chain C from PDB  Type:PROTEIN  Length:442
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..hhhhhhhhhhhhhhh...eeeee.........hhhhhh........hhhhhhee.......ee.....................eee......eeeee....eeee....eeeeeeeee...eee..hhhhhhhhhhhhh.ee...hhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh.eeeeee..........hhhhhhhhhhhhhhhhheeee...eeeeee....eeeee....eeee.eeee...eee..hhhhhhh.........ee.....eee..eee....eeeee...eeee..hhhhhhhhhhhhhhhhh..........eeeee.....eeeeee.......eeeee...ee.......eeeeeee..eeeeeeee....hhhhhhhhhhhh....hhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5miv C 128 PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGEGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKITIPPEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE 611
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507 ||   |559       569       579       589       599       609  
                                                                                                                                                                                                                                                                                                                                                                                                                       509| 544|                                                      
                                                                                                                                                                                                                                                                                                                                                                                                                        540  557
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MIV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MIV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MIV)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5MIV)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln C:194 - Trp C:195   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5miv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AIFM1_MOUSE | Q9Z0X1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AIFM1_MOUSE | Q9Z0X1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AIFM1_MOUSE | Q9Z0X1: 1gv4 3gd3 3gd4 5miu

(-) Related Entries Specified in the PDB File

5miu OXIDIZED STATE