Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LACTOCOCCUS LACTIS THIOREDOXIN REDUCTASE EXPOSED TO VISIBLE LIGHT (60 MIN)
 
Authors :  N. Skjoldager, M. B. Bang, B. Svensson, P. Hagglund, P. Harris
Date :  29 Nov 16  (Deposition) - 12 Apr 17  (Release) - 19 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.92
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Thioredoxin Reductase, Photosensitivity, Reactive Oxygen Species, Fad Si-Face Open Space, Oxygen Pocket, Fad-Nadp+ Complex, Fo-Fr Conformations, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. Skjoldager, M. Blanner Bang, M. Rykr, O. Bjornberg, M. J. Davies, B. Svensson, P. Harris, P. Hagglund
The Structure Of Lactococcus Lactis Thioredoxin Reductase Reveals Molecular Features Of Photo-Oxidative Damage.
Sci Rep V. 7 46282 2017
PubMed-ID: 28397795  |  Reference-DOI: 10.1038/SREP46282

(-) Compounds

Molecule 1 - THIOREDOXIN REDUCTASE
    Chains: A
    EC Number: 1.8.1.9
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Taxid: 562
    Expression System Variant: ROSETTA DE3
    Expression System Vector Type: PLASMID
    Gene: N41_1746, NCDO763_0431
    Organism Scientific: LACTOCOCCUS LACTIS SUBSP. CREMORIS
    Organism Taxid: 1359

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 6)

Asymmetric Unit (4, 6)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2NAP1Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3PEG2Ligand/IonDI(HYDROXYETHYL)ETHER
4SO42Ligand/IonSULFATE ION
Biological Unit 1 (4, 12)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3PEG4Ligand/IonDI(HYDROXYETHYL)ETHER
4SO44Ligand/IonSULFATE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:12 , GLY A:14 , PRO A:15 , ALA A:16 , GLU A:35 , ARG A:36 , GLY A:41 , GLN A:42 , THR A:46 , ASN A:51 , GLY A:81 , PHE A:82 , VAL A:83 , ALA A:110 , THR A:111 , GLY A:112 , SER A:155 , GLU A:159 , VAL A:243 , GLY A:276 , ASP A:277 , ARG A:284 , GLN A:285 , ILE A:286 , NAP A:402 , HOH A:519 , HOH A:524 , HOH A:555 , HOH A:565 , HOH A:569 , HOH A:570 , HOH A:574 , HOH A:577 , HOH A:588 , HOH A:598 , HOH A:620 , HOH A:652 , HOH A:717binding site for residue FAD A 401
2AC2SOFTWAREASN A:51 , ILE A:150 , GLY A:151 , GLY A:152 , GLY A:153 , ASP A:154 , SER A:155 , GLU A:158 , MET A:173 , HIS A:174 , ARG A:175 , ARG A:176 , ARG A:180 , PRO A:203 , TYR A:237 , VAL A:238 , GLY A:239 , LEU A:240 , ARG A:284 , GLN A:285 , FAD A:401 , HOH A:505 , HOH A:524 , HOH A:531 , HOH A:534 , HOH A:549 , HOH A:559 , HOH A:580 , HOH A:595 , HOH A:614 , HOH A:637 , HOH A:649 , HOH A:661binding site for residue NAP A 402
3AC3SOFTWARESER A:13 , PRO A:39 , ASN A:78 , HOH A:502 , HOH A:506binding site for residue PEG A 403
4AC4SOFTWAREARG A:266 , THR A:267binding site for residue PEG A 404
5AC5SOFTWAREPRO A:121 , GLY A:122 , GLU A:123 , GLU A:124 , GLU A:125 , HOH A:518binding site for residue SO4 A 405
6AC6SOFTWAREARG A:116 , ARG A:175 , HOH A:642binding site for residue SO4 A 406

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:134 -A:137

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5MIQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MIQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MIQ)

(-) Exons   (0, 0)

(no "Exon" information available for 5MIQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:303
                                                                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhh...eeeee....hhhhhhh.ee........eehhhhhhhhhh.......eeee..eeeeee....eeeee...eeeeeeeee...eee...............ee.hhhhhhhhhh..eeeee..hhhhhhhhhhhh....eeeee........hhhhhhhhhhh..eeee..eeeeeeee....eeeeeeee.....eeeee..eeee...eee.hhhhhhhh....................eee.hhhh.....hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5miq A   5 KYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMGPELSMKMAEPLEGLGVENAYGFVTGIEDHGDYKKIITEDDEFITKSIIIATGANHRKLEIPGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGDSAVEEALYLTRFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKIQSVVYKNVKTGEVTEKAFGGIFIYVGLDPVAEFVSDLGITDEAGWIITDDHMRTNIPGIFAVGDVRQKDFRQITTAVGDGAQAAQEAYKFVVEL 307
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MIQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MIQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MIQ)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5MIQ)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5miq)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5miq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A166TWQ7_L | A0A166TWQ7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.8.1.9
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A166TWQ7_L | A0A166TWQ7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A0A166TWQ7_L | A0A166TWQ7: 5mh4 5mip 5mir 5mis 5mit 5mjk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MIQ)