Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYO-EM STRUCTURE OF THE PSII SUPERCOMPLEX FROM ARABIDOPSIS THALIANA
 
Authors :  L. S. Van Bezouwen, S. Caffarri, R. S. Kale, R. Kouril, A. M. W. H. Thunni G. T. Oostergetel, E. J. Boekema
Date :  13 Nov 16  (Deposition) - 21 Jun 17  (Release) - 21 Jun 17  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  5.30
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H,I,K,L,M,N,O,R,S,T,W,X,Y,Z,a,b,c,d,e,f,g,h,i,k,l,m,n,o,r,s,t,w,x,y,z,1,2,3,4,5,6,7,8
Keywords :  Photosynthesis, Photosystem Ii Supercomplex, Single Particle Analysis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. S. Van Bezouwen, S. Caffarri, R. S. Kale, R. Kouril, A. W. H. Thunnissen, G. T. Oostergetel, E. J. Boekema
Subunit And Chlorophyll Organization Of The Plant Photosystem Ii Supercomplex.
Nat Plants V. 3 17080 2017
PubMed-ID: 28604725  |  Reference-DOI: 10.1038/NPLANTS.2017.80

(-) Compounds

Molecule 1 - PHOTOSYSTEM II PROTEIN D1
    Chains: A, a
    EC Number: 1.10.3.9
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII D1 PROTEIN,PHOTOSYSTEM II Q(B) PROTEIN
 
Molecule 2 - PHOTOSYSTEM II CP47 REACTION CENTER PROTEIN
    Chains: B, b
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII 47 KDA PROTEIN,PROTEIN CP-47
 
Molecule 3 - PHOTOSYSTEM II CP43 REACTION CENTER PROTEIN
    Chains: C, c
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII 43 KDA PROTEIN,PROTEIN CP-43
 
Molecule 4 - PHOTOSYSTEM II D2 PROTEIN
    Chains: D, d
    EC Number: 1.10.3.9
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII D2 PROTEIN,PHOTOSYSTEM Q(A) PROTEIN
 
Molecule 5 - CYTOCHROME B559 SUBUNIT ALPHA
    Chains: E, e
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII REACTION CENTER SUBUNIT V
 
Molecule 6 - CYTOCHROME B559 SUBUNIT BETA (PSBF)
    Chains: F, f
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
 
Molecule 7 - PHOTOSYSTEM II REACTION CENTER PROTEIN H
    Chains: H, h
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-H,PHOTOSYSTEM II 10 KDA PHOSPHOPROTEIN
 
Molecule 8 - PHOTOSYSTEM II REACTION CENTER PROTEIN I
    Chains: I, i
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-I,PSII 4.8 KDA PROTEIN
 
Molecule 9 - PHOTOSYSTEM II REACTION CENTER PROTEIN K
    Chains: K, k
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-K
 
Molecule 10 - PHOTOSYSTEM II REACTION CENTER PROTEIN L
    Chains: L, l
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-L
 
Molecule 11 - PHOTOSYSTEM II REACTION CENTER PROTEIN M
    Chains: M, m
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-M
 
Molecule 12 - OXYGEN-EVOLVING ENHANCER PROTEIN 1-1, CHLOROPLASTIC
    Chains: O, o
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: OEE1,33 KDA SUBUNIT OF OXYGEN EVOLVING SYSTEM OF PHOTOSYSTEM II,33 KDA THYLAKOID MEMBRANE PROTEIN,MANGANESE-STABILIZING PROTEIN 1, MSP-1,OEC 33 KDA SUBUNIT
 
Molecule 13 - PHOTOSYSTEM II REACTION CENTER PROTEIN T
    Chains: T, t
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-T
 
Molecule 14 - PHOTOSYSTEM II REACTION CENTER W PROTEIN, CHLOROPLASTIC
    Chains: W, w
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII 6.1 KDA PROTEIN
 
Molecule 15 - PHOTOSYSTEM II REACTION CENTER PROTEIN X
    Chains: X, x
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSBX,PHOTOSYSTEM II SUBUNIT X,PUTATIVE PSII-X PROTEIN, PUTATIVE UNCHARACTERIZED PROTEIN AT2G06520
 
Molecule 16 - PHOTOSYSTEM II REACTION CENTER PROTEIN Z
    Chains: Z, z
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: PSII-Z
 
Molecule 17 - CHLOROPHYLL A-B BINDING PROTEIN CP29.1, CHLOROPLASTIC
    Chains: R, r
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: LHCB4.1,LHCII PROTEIN 4.1
 
Molecule 18 - CHLOROPHYLL A-B BINDING PROTEIN CP26, CHLOROPLASTIC
    Chains: S, s
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: LHCB5,LHCIIC,LIGHT-HARVESTING COMPLEX II PROTEIN 5
 
Molecule 19 - CHLOROPHYLL A-B BINDING PROTEIN 1, CHLOROPLASTIC
    Chains: G, N, Y, g, n, y, 1, 2, 3, 5, 6, 7
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702
    Synonym: CHLOROPHYLL A-B PROTEIN 140,CAB-140,LHCII TYPE I CAB-1
 
Molecule 20 - CHLOROPHYLL A-B BINDING PROTEIN, CHLOROPLASTIC
    Chains: 4, 8
    Organism Common: MOUSE-EAR CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223242526272829303132333435363738394041424344454647484950
Asymmetric/Biological Unit : ABCDEFGHIKLMNORSTWXYZabcdefghiklmnorstwxyz12345678

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 316)

Asymmetric/Biological Unit (5, 316)
No.NameCountTypeFull Name
1CHL96Ligand/IonCHLOROPHYLL B
2CLA212Ligand/IonCHLOROPHYLL A
3FE22Ligand/IonFE (II) ION
4HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
5PHO4Ligand/IonPHEOPHYTIN A

(-) Sites  (352, 352)

Asymmetric Unit (352, 352)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREHIS A:215 , HIS A:272 , HIS D:215 , HIS D:269binding site for residue FE2 A 401
002AC2SOFTWAREVAL A:157 , MET A:183 , PHE A:186 , GLN A:187 , ILE A:192 , HIS A:198 , VAL A:202 , PHE A:206 , THR A:286 , ILE A:290 , CLA A:403 , PHO A:404 , ILE D:183 , CLA D:401 , CLA D:403binding site for residue CLA A 402
003AC3SOFTWAREMET A:199 , CLA A:402 , PHE D:158 , PHE D:174 , VAL D:176 , ILE D:179 , PHE D:180 , ILE D:183 , PHO D:402 , CLA D:403binding site for residue CLA A 403
004AC4SOFTWARETYR A:126 , GLU A:130 , TYR A:147 , PRO A:150 , ILE A:283 , CLA A:402 , LEU D:210 , ILE D:214 , PHE D:258 , CLA D:401binding site for residue PHO A 404
005AC5SOFTWARELEU A:36 , PRO A:39 , THR A:43 , PHE A:93 , PRO A:95 , ILE A:96 , TRP A:97 , LEU A:114 , HIS A:118 , LEU A:121 , PHE I:15binding site for residue CLA A 405
006AC6SOFTWARETRP B:185 , GLY B:186 , VAL B:187 , PHE B:190 , CLA B:602 , PHE H:53 , ILE H:60binding site for residue CLA B 601
007AC7SOFTWAREGLY B:189 , PHE B:190 , GLY B:197 , SER B:200 , HIS B:201 , ALA B:204 , ALA B:205 , LEU B:208 , VAL B:251 , CLA B:601 , CLA B:603 , PHE H:50 , LEU H:54 , ILE H:57 , TYR H:61binding site for residue CLA B 602
008AC8SOFTWAREARG B:68 , LEU B:69 , SER B:146 , CYS B:150 , PHE B:153 , ILE B:166 , HIS B:201 , HIS B:202 , VAL B:251 , VAL B:252 , THR B:255 , CLA B:602 , CLA B:605binding site for residue CLA B 603
009AC9SOFTWARETRP B:33 , PHE B:65 , VAL B:245 , ALA B:249 , PHE B:451 , HIS B:455 , PHE B:458 , PHE B:462 , CLA B:605 , CLA B:607 , CLA B:613binding site for residue CLA B 604
010AD1SOFTWARETHR B:27 , VAL B:30 , ALA B:34 , VAL B:62 , MET B:66 , HIS B:100 , PHE B:103 , CLA B:603 , CLA B:604 , CLA B:606binding site for residue CLA B 605
011AD2SOFTWARETRP B:91 , GLY B:152 , PHE B:153 , PHE B:156 , HIS B:157 , TYR B:162 , PRO B:164 , CLA B:605binding site for residue CLA B 606
012AD3SOFTWARETRP B:33 , MET B:37 , TYR B:40 , GLY B:59 , PHE B:61 , ARG B:326 , ALA B:327 , GLY B:328 , TRP B:450 , CLA B:604binding site for residue CLA B 607
013AD4SOFTWARETHR B:236 , SER B:239 , SER B:240 , ALA B:243 , PHE B:246 , PHE B:247 , PHE B:463 , HIS B:466 , CLA B:610 , ILE D:124 , PHE D:131binding site for residue CLA B 608
014AD5SOFTWAREPHE B:139 , PHE B:215 , HIS B:216 , VAL B:219 , PRO B:221 , LEU B:229 , CLA B:610 , THR H:39 , MET H:43 , MET H:47binding site for residue CLA B 609
015AD6SOFTWARELEU B:135 , PHE B:139 , HIS B:142 , MET B:231 , VAL B:237 , SER B:240 , CLA B:608 , CLA B:609binding site for residue CLA B 610
016AD7SOFTWARETYR B:6 , ARG B:7 , VAL B:8 , HIS B:9 , THR B:10 , LEU B:238 , ILE B:242 , LEU B:461 , PHE B:462 , PHE B:464 , GLY B:465 , TRP B:468 , HIS B:469 , ARG B:472 , CLA B:612 , CLA B:613binding site for residue CLA B 611
017AD8SOFTWAREHIS B:9 , LEU B:19 , VAL B:22 , HIS B:23 , HIS B:26 , ILE B:234 , VAL B:237 , LEU B:238 , SER B:241 , CLA B:611 , CLA B:613 , CLA B:615binding site for residue CLA B 612
018AD9SOFTWAREHIS B:9 , HIS B:26 , VAL B:30 , PHE B:462 , CLA B:604 , CLA B:611 , CLA B:612 , CLA B:614binding site for residue CLA B 613
019AE1SOFTWARELEU B:3 , VAL B:8 , HIS B:9 , VAL B:11 , VAL B:12 , TRP B:115 , CLA B:613 , GLU L:8 , VAL L:11 , PHE M:21 , LYS M:28binding site for residue CLA B 614
020AE2SOFTWARELEU B:20 , HIS B:23 , ILE B:24 , THR B:27 , ILE B:138 , HIS B:142 , CLA B:612 , CLA B:616binding site for residue CLA B 615
021AE3SOFTWARELEU B:20 , ILE B:24 , ALA B:110 , TRP B:113 , HIS B:114 , CLA B:615 , THR H:17 , VAL H:19binding site for residue CLA B 616
022AE4SOFTWARETRP C:63 , ILE C:87 , HIS C:91 , LEU C:279 , GLY C:283 , TYR C:297 , HIS C:430 , LEU C:433 , CLA C:502 , CLA C:503 , CLA C:504 , CLA C:510binding site for residue CLA C 501
023AE5SOFTWAREVAL C:61 , LEU C:88 , LEU C:92 , SER C:114 , HIS C:118 , CLA C:501 , CLA C:503binding site for residue CLA C 502
024AE6SOFTWARELEU C:95 , LEU C:175 , ILE C:233 , HIS C:237 , PHE C:289 , ALA C:296 , TYR C:297 , CLA C:501 , CLA C:502binding site for residue CLA C 503
025AE7SOFTWARETRP C:63 , GLY C:85 , TRP C:425 , CLA C:501 , PRO K:41binding site for residue CLA C 504
026AE8SOFTWARETRP A:131 , TYR C:274 , VAL C:281 , PHE C:438 , HIS C:441 , ALA C:445 , ARG C:449 , CLA C:507binding site for residue CLA C 505
027AE9SOFTWARELEU C:165 , ILE C:243 , GLY C:247 , TRP C:250 , HIS C:251 , THR C:254 , PHE C:257 , CLA C:507binding site for residue CLA C 506
028AF1SOFTWARELEU C:161 , HIS C:164 , LEU C:165 , LEU C:168 , TYR C:271 , TYR C:274 , SER C:275 , CLA C:505 , CLA C:506 , CLA C:509binding site for residue CLA C 507
029AF2SOFTWARETRP C:36 , ALA C:37 , GLY C:38 , ASN C:39 , GLU C:269 , LEU C:276 , PHE C:436 , GLY C:440 , TRP C:443 , HIS C:444 , ARG C:447 , CLA C:509 , CLA C:510binding site for residue CLA C 508
030AF3SOFTWAREASN C:39 , ILE C:43 , LEU C:49 , HIS C:53 , HIS C:56 , GLY C:268 , LEU C:272 , SER C:275 , CLA C:507 , CLA C:508 , CLA C:511binding site for residue CLA C 509
031AF4SOFTWAREHIS C:56 , ILE C:60 , CLA C:501 , CLA C:508 , CLA C:511 , PRO K:44binding site for residue CLA C 510
032AF5SOFTWAREGLY C:25 , TRP C:35 , GLY C:38 , ASN C:39 , LEU C:42 , LEU C:45 , LYS C:48 , CLA C:509 , CLA C:510 , TRP K:54 , GLN K:55binding site for residue CLA C 511
033AF6SOFTWAREALA C:57 , ILE C:160 , ILE C:163 , HIS C:164 , LEU C:167 , CLA S:301binding site for residue CLA C 512
034AF7SOFTWAREVAL A:157 , MET A:172 , ILE A:176 , THR A:179 , PHE A:180 , MET A:183 , CLA A:402 , PHO A:404 , MET D:199 , VAL D:202binding site for residue CLA D 401
035AF8SOFTWARELEU A:210 , ALA A:213 , MET A:214 , CLA A:403 , PHE D:126 , GLN D:130 , ASN D:143 , ALA D:146 , PHE D:147 , PRO D:150 , LEU D:280 , CLA D:403binding site for residue PHO D 402
036AF9SOFTWAREMET A:183 , CLA A:402 , CLA A:403 , VAL D:153 , ILE D:183 , PHE D:186 , GLN D:187 , TRP D:192 , THR D:193 , HIS D:198 , GLY D:201 , VAL D:202 , VAL D:205 , SER D:283 , VAL D:287 , PHO D:402binding site for residue CLA D 403
037AG1SOFTWAREPRO D:40 , PHE D:44 , LEU D:90 , LEU D:91 , LEU D:92 , LEU D:93 , TRP D:105 , PHE D:114 , HIS D:118 , PHE D:121binding site for residue CLA D 404
038AG2SOFTWAREILE E:13 , HIS E:23 , THR E:26 , ARG F:13 , TRP F:14 , VAL F:17 , HIS F:18 , ALA F:21binding site for residue HEM E 101
039AG3SOFTWAREHIS a:215 , HIS a:272 , HIS d:215 , HIS d:269binding site for residue FE2 a 401
040AG4SOFTWAREALA a:153 , VAL a:157 , MET a:183 , PHE a:186 , GLN a:187 , ILE a:192 , HIS a:198 , VAL a:202 , THR a:286 , ILE a:290 , CLA d:401 , CLA d:403binding site for residue CLA a 402
041AG5SOFTWAREMET a:199 , VAL a:202 , ALA a:203 , PHE d:158 , VAL d:176 , PHE d:180 , ILE d:183 , PHO d:402 , CLA d:403binding site for residue CLA a 403
042AG6SOFTWARETYR a:126 , GLU a:130 , TYR a:147 , PRO a:150 , ILE a:283 , LEU d:210 , PHE d:258 , CLA d:401binding site for residue PHO a 404
043AG7SOFTWARELEU a:36 , PRO a:39 , THR a:43 , PHE a:93 , PRO a:95 , TRP a:97 , LEU a:114 , HIS a:118 , LEU a:121 , VAL i:8 , VAL i:12 , PHE i:15binding site for residue CLA a 405
044AG8SOFTWAREGLY b:186 , VAL b:187 , PHE h:53binding site for residue CLA b 601
045AG9SOFTWAREGLY b:189 , PHE b:190 , GLY b:197 , SER b:200 , HIS b:201 , ALA b:204 , ALA b:205 , LEU b:208 , VAL b:251 , CLA b:603binding site for residue CLA b 602
046AH1SOFTWAREARG b:68 , LEU b:69 , ILE b:198 , HIS b:201 , HIS b:202 , VAL b:251 , VAL b:252 , THR b:255 , THR b:262 , CLA b:602 , CLA b:605binding site for residue CLA b 603
047AH2SOFTWARETRP b:33 , PHE b:61 , PHE b:65 , VAL b:245 , ALA b:248 , ALA b:249 , VAL b:252 , PHE b:451 , HIS b:455 , PHE b:458 , PHE b:462 , CLA b:605 , CLA b:607 , CLA b:613binding site for residue CLA b 604
048AH3SOFTWAREALA b:34 , VAL b:62 , PHE b:65 , MET b:66 , ARG b:68 , HIS b:100 , PHE b:103 , CLA b:603 , CLA b:604 , CLA b:606binding site for residue CLA b 605
049AH4SOFTWARELEU b:69 , GLY b:70 , ILE b:71 , TRP b:91 , VAL b:96 , GLY b:152 , PHE b:153 , PHE b:156 , HIS b:157 , TYR b:162 , PRO b:164 , CLA b:605binding site for residue CLA b 606
050AH5SOFTWAREGLY b:59 , PHE b:61 , ARG b:326 , ALA b:327 , GLY b:328 , PRO b:447 , TRP b:450 , CLA b:604binding site for residue CLA b 607
051AH6SOFTWARETHR b:236 , SER b:239 , SER b:240 , ALA b:243 , PHE b:246 , PHE b:247 , PHE b:463 , HIS b:466 , ILE b:467 , CLA b:610 , MET d:127binding site for residue CLA b 608
052AH7SOFTWAREPHE b:139 , LEU b:143 , HIS b:216 , PRO b:221 , PRO b:222 , LEU b:229 , CLA b:610 , MET h:47binding site for residue CLA b 609
053AH8SOFTWARELEU b:135 , PHE b:139 , HIS b:142 , MET b:231 , VAL b:237 , SER b:240 , CLA b:608 , CLA b:609binding site for residue CLA b 610
054AH9SOFTWARETYR b:6 , ARG b:7 , VAL b:8 , HIS b:9 , THR b:10 , ILE b:242 , LEU b:461 , PHE b:462 , PHE b:464 , GLY b:465 , TRP b:468 , HIS b:469 , ARG b:472 , CLA b:612 , CLA b:613binding site for residue CLA b 611
055AI1SOFTWAREHIS b:9 , LEU b:19 , VAL b:22 , HIS b:23 , HIS b:26 , VAL b:237 , LEU b:238 , SER b:241 , CLA b:611 , CLA b:613 , CLA b:614 , CLA b:615binding site for residue CLA b 612
056AI2SOFTWAREHIS b:26 , PHE b:462 , CLA b:604 , CLA b:611 , CLA b:612 , CLA b:614binding site for residue CLA b 613
057AI3SOFTWAREHIS b:9 , LEU b:29 , TRP b:115 , CLA b:612 , CLA b:613 , VAL l:11 , PHE m:21 , LYS m:28binding site for residue CLA b 614
058AI4SOFTWARELEU b:20 , HIS b:23 , ILE b:24 , THR b:27 , HIS b:142 , LEU b:145 , CLA b:612 , CLA b:616binding site for residue CLA b 615
059AI5SOFTWARECYS b:107 , ALA b:110 , TRP b:113 , HIS b:114 , CLA b:615 , THR h:17binding site for residue CLA b 616
060AI6SOFTWAREILE a:176 , PHE a:180 , MET a:183 , CLA a:402 , PHO a:404 , MET d:199binding site for residue CLA d 401
061AI7SOFTWARELEU a:210 , MET a:214 , CLA a:403 , PHE d:126 , GLN d:130 , ASN d:143 , ALA d:146 , PHE d:147 , LEU d:280 , CLA d:403binding site for residue PHO d 402
062AI8SOFTWAREPHE a:206 , CLA a:402 , CLA a:403 , VAL d:153 , ILE d:183 , PHE d:186 , GLN d:187 , TRP d:192 , THR d:193 , HIS d:198 , GLY d:201 , VAL d:202 , VAL d:205 , SER d:283 , VAL d:287 , PHO d:402binding site for residue CLA d 403
063AI9SOFTWAREPRO d:40 , CYS d:41 , PHE d:44 , LEU d:90 , LEU d:91 , LEU d:92 , LEU d:93 , PHE d:114 , HIS d:118 , PHE d:121binding site for residue CLA d 404
064AJ1SOFTWAREILE e:13 , ARG e:18 , TYR e:19 , HIS e:23 , THR e:26 , TRP f:14 , HIS f:18binding site for residue HEM e 101
065AJ2SOFTWARETRP c:63 , HIS c:91 , LEU c:279 , TYR c:297 , HIS c:430 , LEU c:433 , CLA c:502 , CLA c:503 , CLA c:504 , CLA c:510binding site for residue CLA c 501
066AJ3SOFTWAREVAL c:61 , LEU c:88 , SER c:114 , HIS c:118 , CLA c:501 , CLA c:503binding site for residue CLA c 502
067AJ4SOFTWARELEU c:95 , LEU c:168 , LEU c:175 , ILE c:233 , HIS c:237 , LEU c:240 , PHE c:289 , TYR c:297 , CLA c:501 , CLA c:502binding site for residue CLA c 503
068AJ5SOFTWARETRP c:63 , GLY c:85 , CLA c:501 , PRO k:41binding site for residue CLA c 504
069AJ6SOFTWAREPHE a:33 , TRP a:131 , TYR c:274 , VAL c:281 , PHE c:438 , HIS c:441 , ALA c:445 , ARG c:449 , CLA c:507 , PHE i:23binding site for residue CLA c 505
070AJ7SOFTWARELEU c:161 , LEU c:165 , ILE c:243 , GLY c:247 , TRP c:250 , HIS c:251 , THR c:254 , PHE c:257 , LEU c:264 , CLA c:507binding site for residue CLA c 506
071AJ8SOFTWAREMET c:157 , THR c:158 , LEU c:161 , HIS c:164 , TRP c:266 , TYR c:271 , TYR c:274 , SER c:275 , CLA c:505 , CLA c:506 , CLA c:509binding site for residue CLA c 507
072AJ9SOFTWARETRP c:36 , ALA c:37 , GLY c:38 , ASN c:39 , GLU c:269 , LEU c:272 , PHE c:436 , GLY c:440 , TRP c:443 , HIS c:444 , ARG c:447 , CLA c:509 , CLA c:510binding site for residue CLA c 508
073AK1SOFTWAREASN c:39 , ILE c:43 , LEU c:49 , HIS c:53 , HIS c:56 , GLY c:268 , LEU c:272 , SER c:275 , CLA c:507 , CLA c:508 , CLA c:510 , CLA c:511 , CLA c:512binding site for residue CLA c 509
074AK2SOFTWAREHIS c:56 , ILE c:60 , CLA c:501 , CLA c:508 , CLA c:509 , CLA c:511 , LEU k:48binding site for residue CLA c 510
075AK3SOFTWAREGLY c:25 , TRP c:35 , GLY c:38 , ASN c:39 , LEU c:42 , LEU c:45 , LYS c:48 , CLA c:509 , CLA c:510 , TRP k:54 , GLN k:55binding site for residue CLA c 511
076AK4SOFTWAREALA c:57 , PHE c:146 , ILE c:160 , ILE c:163 , HIS c:164 , CLA c:509 , CLA s:301binding site for residue CLA c 512
077AK5SOFTWARETRP R:67 , LEU R:68 , GLY R:74 , ASP R:75 , TYR R:76 , GLY R:77 , PHE R:78 , LEU R:83 , PHE R:136 , ARG R:137 , GLU R:140 , ARG R:247 , CLA R:302binding site for residue CLA R 301
078AK6SOFTWAREARG R:135 , PHE R:136 , CYS R:139 , HIS R:143 , CLA R:301 , CLA R:307 , LEU b:214binding site for residue CLA R 302
079AK7SOFTWARELEU R:149 , ALA R:150 , GLY R:153 , SER R:156 , VAL R:157 , THR R:161 , GLU R:172 , SER R:178 , TYR R:179 , LEU R:180 , CHL R:304binding site for residue CLA R 303
080AK8SOFTWARELEU R:184 , LEU R:191 , GLU R:195 , ILE R:199 , CLA R:303 , CHL R:305binding site for residue CHL R 304
081AK9SOFTWAREGLN R:166 , ASP R:167 , GLY R:169 , LYS R:170 , LEU R:173 , ILE R:192 , CHL R:304 , LEU b:161binding site for residue CHL R 305
082AL1SOFTWAREARG R:145 , TRP R:146 , ILE R:202 , GLN R:205 , ARG R:206 , ALA R:208 , GLU R:209 , PHE R:223 , CLA R:308binding site for residue CHL R 306
083AL2SOFTWAREHIS R:143 , TRP R:146 , GLU R:203 , PHE R:204 , ARG R:206 , ASN R:207 , ARG R:215 , CLA R:302binding site for residue CLA R 307
084AL3SOFTWAREARG R:145 , MET R:148 , LEU R:149 , TYR R:217 , PRO R:218 , GLY R:219 , PHE R:223 , ASP R:224 , LEU R:228 , LEU R:238 , GLU R:242 , HIS R:245 , CHL R:306 , CLA R:310binding site for residue CLA R 308
085AL4SOFTWAREGLN R:237 , LYS R:244 , HIS R:245 , CLA R:310binding site for residue CLA R 309
086AL5SOFTWAREHIS R:245 , LEU R:248 , CLA R:308 , CLA R:309binding site for residue CLA R 310
087AL6SOFTWARECHL 8:301 , GLY R:255 , PHE R:256 , GLN R:259 , THR R:263 , ASN R:270 , HIS R:274 , THR R:281 , THR R:282 , ILE R:283 , THR R:286binding site for residue CLA R 311
088AL7SOFTWAREVAL C:124 , GLY C:128 , TYR C:131 , HIS C:132 , PHE C:147 , CLA C:512 , ASP S:73 , GLY S:74 , LEU S:75binding site for residue CLA S 301
089AL8SOFTWAREARG S:68 , PHE S:70 , TYR S:93 , CLA S:303 , CLA S:311binding site for residue CHL S 302
090AL9SOFTWAREASP S:92 , TYR S:93 , TYR S:95 , ASP S:96 , PRO S:97 , GLY S:99 , PHE S:107 , TYR S:110 , GLN S:111 , GLU S:114 , ARG S:230 , MET S:233 , CHL S:302 , CLA S:304binding site for residue CLA S 303
091AM1SOFTWARETYR S:110 , PHE S:113 , HIS S:117 , CLA S:303 , CLA S:309binding site for residue CLA S 304
092AM2SOFTWARELEU S:123 , GLY S:124 , GLY S:127 , PHE S:128 , ILE S:130 , PRO S:131 , ASN S:140 , CYS S:141 , GLY S:142 , THR S:150 , ASN S:161 , CHL S:306binding site for residue CLA S 305
093AM3SOFTWAREGLU S:178 , CLA S:305 , CHL S:307binding site for residue CHL S 306
094AM4SOFTWAREPHE S:148 , GLY S:151 , ALA S:152 , LEU S:171 , VAL S:175 , CHL S:306binding site for residue CHL S 307
095AM5SOFTWAREARG S:119 , TRP S:120 , TYR S:188 , ARG S:189 , ASN S:192 , ASP S:195 , LYS S:199 , PRO S:202 , PHE S:206 , CLA S:310binding site for residue CHL S 308
096AM6SOFTWAREPHE S:113 , ILE S:116 , HIS S:117 , TRP S:120 , LEU S:182 , GLY S:183 , GLU S:186 , ARG S:189 , ILE S:190 , CLA S:304binding site for residue CLA S 309
097AM7SOFTWAREARG S:119 , LEU S:123 , HIS S:201 , PRO S:202 , PHE S:206 , ASP S:207 , PRO S:208 , LEU S:211 , LEU S:221 , GLU S:225 , ASN S:228 , CHL S:308binding site for residue CLA S 310
098AM8SOFTWARELYS S:227 , CHL S:302 , CLA S:312binding site for residue CLA S 311
099AM9SOFTWARELYS S:224 , ASN S:228 , LEU S:231 , CLA S:311binding site for residue CLA S 312
100AN1SOFTWAREPHE S:234 , GLY S:238 , ILE S:241 , GLN S:242 , THR S:246 , ASN S:253 , LEU S:254 , HIS S:257 , ASN S:265 , LEU S:266 , VAL S:269 , CLA S:314binding site for residue CLA S 313
101AN2SOFTWAREPHE C:182 , HIS S:257 , ASN S:265 , CLA S:313binding site for residue CLA S 314
102AN3SOFTWARELYS G:57 , TYR G:58 , LEU G:59 , PRO G:61 , TRP G:80 , CLA G:611 , CHL Y:609binding site for residue CHL G 601
103AN4SOFTWARELEU G:70 , GLY G:76 , ASP G:77 , TYR G:78 , GLY G:79 , TRP G:80 , ASP G:81 , PHE G:92 , ASN G:95 , ARG G:96 , LEU G:98 , GLU G:99 , HIS G:102 , ARG G:220 , MET G:223binding site for residue CLA G 602
104AN5SOFTWAREHIS G:102 , CHL G:609binding site for residue CLA G 603
105AN6SOFTWARELEU G:108 , GLY G:112 , PRO G:116 , TYR G:146 , LEU G:147 , CHL G:606binding site for residue CLA G 604
106AN7SOFTWARESER G:151 , LEU G:152 , VAL G:153 , HIS G:154 , GLN G:156 , SER G:157 , ILE G:161binding site for residue CHL G 605
107AN8SOFTWARETRP G:105 , LEU G:144 , GLN G:165 , MET G:169 , CLA G:604 , CHL G:607binding site for residue CHL G 606
108AN9SOFTWAREPHE G:132 , LYS G:133 , GLY G:135 , TRP G:162 , CHL G:606 , TRP N:257 , ALA N:260binding site for residue CHL G 607
109AO1SOFTWAREARG G:104 , TRP G:105 , VAL G:172 , TYR G:175 , ARG G:176 , GLY G:181 , PRO G:182 , LEU G:183 , GLY G:184 , GLU G:185 , PRO G:192 , PHE G:196 , CLA G:610binding site for residue CHL G 608
110AO2SOFTWAREGLU G:97 , LEU G:98 , ILE G:101 , HIS G:102 , TRP G:105 , MET G:169 , GLY G:170 , GLU G:173 , CLA G:603 , THR N:82 , CHL N:601binding site for residue CHL G 609
111AO3SOFTWAREARG G:104 , MET G:107 , TYR G:191 , PRO G:192 , GLY G:193 , PHE G:196 , ASP G:197 , PRO G:198 , PHE G:208 , LEU G:211 , GLU G:215 , ASN G:218 , CHL G:608 , CLA G:612binding site for residue CLA G 610
112AO4SOFTWARELEU 5:199 , TRP G:50 , LYS G:214 , LYS G:217 , CHL G:601 , CLA G:612binding site for residue CLA G 611
113AO5SOFTWARELYS G:214 , ASN G:218 , LEU G:221 , CLA G:610 , CLA G:611binding site for residue CLA G 612
114AO6SOFTWAREPHE G:224 , SER G:225 , GLY G:228 , GLN G:232 , THR G:236 , ASN G:243 , HIS G:247 , ASN G:254 , ASN G:255 , ALA G:256 , CLA G:614binding site for residue CLA G 613
115AO7SOFTWAREHIS G:247 , PRO G:251 , CLA G:613binding site for residue CLA G 614
116AO8SOFTWARECHL G:609 , LYS N:57 , TYR N:58 , LEU N:59 , PRO N:61 , TRP N:80 , CLA N:611binding site for residue CHL N 601
117AO9SOFTWARELEU N:70 , GLY N:76 , ASP N:77 , TYR N:78 , GLY N:79 , TRP N:80 , ASP N:81 , PHE N:92 , ASN N:95 , ARG N:96 , LEU N:98 , GLU N:99 , HIS N:102 , ARG N:220 , MET N:223binding site for residue CLA N 602
118AP1SOFTWARELEU N:98 , HIS N:102 , CHL N:609 , ALA Y:83binding site for residue CLA N 603
119AP2SOFTWARELEU N:108 , GLY N:112 , PRO N:116 , TYR N:146 , LEU N:147 , CHL N:606binding site for residue CLA N 604
120AP3SOFTWARESER N:151 , LEU N:152 , VAL N:153 , HIS N:154 , GLN N:156 , SER N:157 , ILE N:161binding site for residue CHL N 605
121AP4SOFTWARETRP N:105 , LEU N:144 , GLN N:165 , CLA N:604 , CHL N:607binding site for residue CHL N 606
122AP5SOFTWAREPHE N:132 , LYS N:133 , GLY N:135 , SER N:136 , CHL N:606 , TRP Y:257 , ALA Y:260 , ASN Y:262binding site for residue CHL N 607
123AP6SOFTWAREARG N:104 , TRP N:105 , VAL N:172 , TYR N:175 , ARG N:176 , GLY N:181 , PRO N:182 , LEU N:183 , GLY N:184 , GLU N:185 , PRO N:192 , PHE N:196 , CLA N:610binding site for residue CHL N 608
124AP7SOFTWARELEU N:98 , ILE N:101 , HIS N:102 , TRP N:105 , MET N:169 , GLY N:170 , GLU N:173 , CLA N:603 , CHL Y:601binding site for residue CHL N 609
125AP8SOFTWAREARG N:104 , MET N:107 , TYR N:191 , PRO N:192 , GLY N:193 , PHE N:196 , ASP N:197 , PHE N:208 , LEU N:211 , GLU N:215 , ASN N:218 , CHL N:608binding site for residue CLA N 610
126AP9SOFTWARETRP N:50 , LYS N:214 , LYS N:217 , CHL N:601 , CLA N:612binding site for residue CLA N 611
127AQ1SOFTWARELYS N:214 , ASN N:218 , LEU N:221 , CLA N:611binding site for residue CLA N 612
128AQ2SOFTWAREPHE N:224 , SER N:225 , GLY N:228 , GLN N:232 , THR N:236 , ASN N:243 , HIS N:247 , ASN N:254 , ASN N:255 , ALA N:256 , CLA N:614binding site for residue CLA N 613
129AQ3SOFTWAREHIS N:247 , PRO N:251 , ASN N:255 , CLA N:613binding site for residue CLA N 614
130AQ4SOFTWARECHL N:609 , LYS Y:57 , TYR Y:58 , LEU Y:59 , TRP Y:80 , CLA Y:611binding site for residue CHL Y 601
131AQ5SOFTWAREGLY Y:76 , ASP Y:77 , TYR Y:78 , TRP Y:80 , ASP Y:81 , PHE Y:92 , ASN Y:95 , ARG Y:96 , GLU Y:99 , HIS Y:102 , ARG Y:220 , MET Y:223binding site for residue CLA Y 602
132AQ6SOFTWAREALA G:83 , HIS Y:102 , CHL Y:609binding site for residue CLA Y 603
133AQ7SOFTWARELEU Y:108 , GLY Y:112 , PHE Y:115 , GLN Y:137 , LEU Y:144 , TYR Y:146 , LEU Y:147 , CHL Y:606binding site for residue CLA Y 604
134AQ8SOFTWAREGLN R:182 , LEU R:184 , SER Y:151 , LEU Y:152 , VAL Y:153 , HIS Y:154 , GLN Y:156 , SER Y:157 , ILE Y:161binding site for residue CHL Y 605
135AQ9SOFTWARELEU Y:144 , ILE Y:161 , GLN Y:165 , MET Y:169 , CLA Y:604 , CHL Y:607binding site for residue CHL Y 606
136AR1SOFTWAREALA G:260 , PHE Y:132 , LYS Y:133 , ALA Y:134 , GLY Y:135 , SER Y:136 , TRP Y:162 , CHL Y:606binding site for residue CHL Y 607
137AR2SOFTWAREARG Y:104 , TRP Y:105 , VAL Y:172 , TYR Y:175 , ARG Y:176 , GLY Y:181 , PRO Y:182 , LEU Y:183 , GLY Y:184 , GLU Y:185 , PRO Y:192 , PHE Y:196 , CLA Y:610binding site for residue CHL Y 608
138AR3SOFTWARETHR G:82 , CHL G:601 , LEU Y:98 , ILE Y:101 , TRP Y:105 , VAL Y:166 , MET Y:169 , GLY Y:170 , GLU Y:173 , CLA Y:603binding site for residue CHL Y 609
139AR4SOFTWAREARG Y:104 , MET Y:107 , TYR Y:191 , PRO Y:192 , GLY Y:193 , PHE Y:196 , ASP Y:197 , PHE Y:208 , LEU Y:211 , GLU Y:215 , ASN Y:218 , CHL Y:608 , CLA Y:612binding site for residue CLA Y 610
140AR5SOFTWARETRP Y:50 , GLU Y:210 , LYS Y:214 , LYS Y:217 , CHL Y:601 , CLA Y:612binding site for residue CLA Y 611
141AR6SOFTWAREPHE W:117 , LYS Y:214 , ASN Y:218 , LEU Y:221 , CLA Y:610 , CLA Y:611binding site for residue CLA Y 612
142AR7SOFTWARESER Y:225 , GLY Y:228 , GLN Y:232 , THR Y:236 , ASN Y:243 , LEU Y:244 , HIS Y:247 , ASN Y:254 , ASN Y:255 , ALA Y:256 , CLA Y:614binding site for residue CLA Y 613
143AR8SOFTWAREPRO C:206 , TRP N:162 , HIS Y:247 , PRO Y:251 , CLA Y:613binding site for residue CLA Y 614
144AR9SOFTWARETRP r:67 , LEU r:68 , GLY r:74 , ASP r:75 , TYR r:76 , GLY r:77 , PHE r:78 , LEU r:83 , PHE r:136 , ARG r:137 , GLU r:140 , ARG r:247 , CLA r:302binding site for residue CLA r 301
145AS1SOFTWARELEU B:214 , SER B:218 , ARG r:135 , PHE r:136 , CYS r:139 , HIS r:143 , CLA r:301 , CLA r:307binding site for residue CLA r 302
146AS2SOFTWARELEU r:149 , ALA r:150 , GLY r:153 , SER r:156 , VAL r:157 , THR r:161 , GLU r:172 , SER r:178 , TYR r:179 , LEU r:180 , CHL r:304binding site for residue CLA r 303
147AS3SOFTWARELEU r:184 , LEU r:191 , GLU r:195 , ILE r:199 , CLA r:303 , CHL r:305binding site for residue CHL r 304
148AS4SOFTWAREGLN r:166 , ASP r:167 , GLY r:169 , LYS r:170 , LEU r:173 , ILE r:192 , CHL r:304binding site for residue CHL r 305
149AS5SOFTWAREARG r:145 , TRP r:146 , ILE r:202 , GLN r:205 , ARG r:206 , ALA r:208 , GLU r:209 , PHE r:223 , CLA r:308binding site for residue CHL r 306
150AS6SOFTWAREHIS r:143 , TRP r:146 , GLU r:203 , PHE r:204 , ARG r:206 , ASN r:207 , ARG r:215 , CLA r:302binding site for residue CLA r 307
151AS7SOFTWAREARG r:145 , MET r:148 , LEU r:149 , TYR r:217 , PRO r:218 , GLY r:219 , PHE r:223 , ASP r:224 , LEU r:228 , LEU r:238 , GLU r:242 , HIS r:245 , CHL r:306 , CLA r:310binding site for residue CLA r 308
152AS8SOFTWAREGLN r:237 , LYS r:244 , HIS r:245 , CLA r:310binding site for residue CLA r 309
153AS9SOFTWAREHIS r:245 , LEU r:248 , CLA r:308 , CLA r:309binding site for residue CLA r 310
154AT1SOFTWARECHL 4:301 , GLY r:255 , PHE r:256 , GLN r:259 , THR r:263 , ASN r:270 , HIS r:274 , THR r:281 , THR r:282 , ILE r:283 , THR r:286binding site for residue CLA r 311
155AT2SOFTWAREGLY c:128 , TYR c:131 , HIS c:132 , PHE c:144 , PHE c:147 , CLA c:512 , ASP s:73 , GLY s:74 , LEU s:75binding site for residue CLA s 301
156AT3SOFTWAREARG s:68 , PHE s:70 , TYR s:93 , CLA s:303 , CLA s:311binding site for residue CHL s 302
157AT4SOFTWAREASP s:92 , TYR s:93 , TYR s:95 , ASP s:96 , PRO s:97 , GLY s:99 , PHE s:107 , TYR s:110 , GLN s:111 , GLU s:114 , ARG s:230 , MET s:233 , CHL s:302 , CLA s:304binding site for residue CLA s 303
158AT5SOFTWARETYR s:110 , PHE s:113 , HIS s:117 , CLA s:303 , CLA s:309binding site for residue CLA s 304
159AT6SOFTWARELEU s:123 , GLY s:124 , GLY s:127 , PHE s:128 , ILE s:130 , PRO s:131 , ASN s:140 , CYS s:141 , GLY s:142 , THR s:150 , ASN s:161 , CHL s:306binding site for residue CLA s 305
160AT7SOFTWAREGLU s:178 , CLA s:305 , CHL s:307binding site for residue CHL s 306
161AT8SOFTWAREPHE s:148 , GLY s:151 , ALA s:152 , LEU s:171 , VAL s:175 , CHL s:306binding site for residue CHL s 307
162AT9SOFTWAREARG s:119 , TRP s:120 , TYR s:188 , ARG s:189 , ASN s:192 , ASP s:195 , LYS s:199 , PRO s:202 , PHE s:206 , CLA s:310binding site for residue CHL s 308
163AU1SOFTWAREPHE s:113 , ILE s:116 , HIS s:117 , TRP s:120 , LEU s:182 , GLY s:183 , GLU s:186 , ARG s:189 , ILE s:190 , CLA s:304binding site for residue CLA s 309
164AU2SOFTWAREARG s:119 , LEU s:123 , HIS s:201 , PRO s:202 , PHE s:206 , ASP s:207 , PRO s:208 , LEU s:211 , LEU s:221 , GLU s:225 , ASN s:228 , CHL s:308binding site for residue CLA s 310
165AU3SOFTWARELYS s:227 , CHL s:302 , CLA s:312binding site for residue CLA s 311
166AU4SOFTWARELYS s:224 , ASN s:228 , LEU s:231 , CLA s:311binding site for residue CLA s 312
167AU5SOFTWAREPHE s:234 , GLY s:238 , ILE s:241 , GLN s:242 , THR s:246 , ASN s:253 , LEU s:254 , HIS s:257 , ASN s:265 , LEU s:266 , VAL s:269 , CLA s:314binding site for residue CLA s 313
168AU6SOFTWAREHIS s:257 , ASN s:265 , CLA s:313binding site for residue CLA s 314
169AU7SOFTWARELYS g:57 , TYR g:58 , LEU g:59 , PRO g:61 , TRP g:80 , CLA g:611 , CHL y:609binding site for residue CHL g 601
170AU8SOFTWARELEU g:70 , GLY g:76 , ASP g:77 , TYR g:78 , GLY g:79 , TRP g:80 , ASP g:81 , PHE g:92 , ASN g:95 , ARG g:96 , LEU g:98 , GLU g:99 , HIS g:102 , ARG g:220 , MET g:223binding site for residue CLA g 602
171AU9SOFTWAREHIS g:102 , CHL g:609binding site for residue CLA g 603
172AV1SOFTWARELEU g:108 , GLY g:112 , PRO g:116 , TYR g:146 , LEU g:147 , CHL g:606binding site for residue CLA g 604
173AV2SOFTWARESER g:151 , LEU g:152 , VAL g:153 , HIS g:154 , GLN g:156 , SER g:157 , ILE g:161binding site for residue CHL g 605
174AV3SOFTWARETRP g:105 , LEU g:144 , GLN g:165 , MET g:169 , CLA g:604 , CHL g:607binding site for residue CHL g 606
175AV4SOFTWAREPHE g:132 , LYS g:133 , GLY g:135 , TRP g:162 , CHL g:606 , TRP n:257 , ALA n:260binding site for residue CHL g 607
176AV5SOFTWAREARG g:104 , TRP g:105 , VAL g:172 , TYR g:175 , ARG g:176 , GLY g:181 , PRO g:182 , LEU g:183 , GLY g:184 , GLU g:185 , PRO g:192 , PHE g:196 , CLA g:610binding site for residue CHL g 608
177AV6SOFTWAREGLU g:97 , LEU g:98 , ILE g:101 , HIS g:102 , TRP g:105 , MET g:169 , GLY g:170 , GLU g:173 , CLA g:603 , THR n:82 , CHL n:601binding site for residue CHL g 609
178AV7SOFTWAREARG g:104 , MET g:107 , TYR g:191 , PRO g:192 , GLY g:193 , PHE g:196 , ASP g:197 , PRO g:198 , PHE g:208 , LEU g:211 , GLU g:215 , ASN g:218 , CHL g:608 , CLA g:612binding site for residue CLA g 610
179AV8SOFTWARELEU 1:199 , TRP g:50 , LYS g:214 , LYS g:217 , CHL g:601 , CLA g:612binding site for residue CLA g 611
180AV9SOFTWARELYS g:214 , ASN g:218 , LEU g:221 , CLA g:610 , CLA g:611binding site for residue CLA g 612
181AW1SOFTWAREPHE g:224 , SER g:225 , GLY g:228 , GLN g:232 , THR g:236 , ASN g:243 , HIS g:247 , ASN g:254 , ASN g:255 , ALA g:256 , CLA g:614binding site for residue CLA g 613
182AW2SOFTWAREHIS g:247 , PRO g:251 , CLA g:613binding site for residue CLA g 614
183AW3SOFTWARECHL g:609 , LYS n:57 , TYR n:58 , LEU n:59 , PRO n:61 , TRP n:80 , CLA n:611binding site for residue CHL n 601
184AW4SOFTWARELEU n:70 , GLY n:76 , ASP n:77 , TYR n:78 , GLY n:79 , TRP n:80 , ASP n:81 , PHE n:92 , ASN n:95 , ARG n:96 , LEU n:98 , GLU n:99 , HIS n:102 , ARG n:220 , MET n:223binding site for residue CLA n 602
185AW5SOFTWARELEU n:98 , HIS n:102 , CHL n:609 , ALA y:83binding site for residue CLA n 603
186AW6SOFTWARELEU n:108 , GLY n:112 , PRO n:116 , TYR n:146 , LEU n:147 , CHL n:606binding site for residue CLA n 604
187AW7SOFTWARESER n:151 , LEU n:152 , VAL n:153 , HIS n:154 , GLN n:156 , SER n:157 , ILE n:161binding site for residue CHL n 605
188AW8SOFTWARETRP n:105 , LEU n:144 , GLN n:165 , CLA n:604 , CHL n:607binding site for residue CHL n 606
189AW9SOFTWAREPHE n:132 , LYS n:133 , GLY n:135 , SER n:136 , CHL n:606 , TRP y:257 , ALA y:260 , ASN y:262binding site for residue CHL n 607
190AX1SOFTWAREARG n:104 , TRP n:105 , VAL n:172 , TYR n:175 , ARG n:176 , GLY n:181 , PRO n:182 , LEU n:183 , GLY n:184 , GLU n:185 , PRO n:192 , PHE n:196 , CLA n:610binding site for residue CHL n 608
191AX2SOFTWARELEU n:98 , ILE n:101 , HIS n:102 , TRP n:105 , MET n:169 , GLY n:170 , GLU n:173 , CLA n:603 , CHL y:601binding site for residue CHL n 609
192AX3SOFTWAREARG n:104 , MET n:107 , TYR n:191 , PRO n:192 , GLY n:193 , PHE n:196 , ASP n:197 , PHE n:208 , LEU n:211 , GLU n:215 , ASN n:218 , CHL n:608binding site for residue CLA n 610
193AX4SOFTWARETRP n:50 , LYS n:214 , LYS n:217 , CHL n:601 , CLA n:612binding site for residue CLA n 611
194AX5SOFTWARELYS n:214 , ASN n:218 , LEU n:221 , CLA n:611binding site for residue CLA n 612
195AX6SOFTWAREPHE n:224 , SER n:225 , GLY n:228 , GLN n:232 , THR n:236 , ASN n:243 , HIS n:247 , ASN n:254 , ASN n:255 , ALA n:256 , CLA n:614binding site for residue CLA n 613
196AX7SOFTWAREHIS n:247 , PRO n:251 , ASN n:255 , CLA n:613binding site for residue CLA n 614
197AX8SOFTWARECHL n:609 , LYS y:57 , TYR y:58 , LEU y:59 , TRP y:80 , CLA y:611binding site for residue CHL y 601
198AX9SOFTWAREGLY y:76 , ASP y:77 , TYR y:78 , TRP y:80 , ASP y:81 , PHE y:92 , ASN y:95 , ARG y:96 , GLU y:99 , HIS y:102 , ARG y:220 , MET y:223binding site for residue CLA y 602
199AY1SOFTWAREALA g:83 , HIS y:102 , CHL y:609binding site for residue CLA y 603
200AY2SOFTWARELEU y:108 , GLY y:112 , PHE y:115 , GLN y:137 , LEU y:144 , TYR y:146 , LEU y:147 , CHL y:606binding site for residue CLA y 604
201AY3SOFTWAREGLN r:182 , LEU r:184 , SER y:151 , LEU y:152 , VAL y:153 , HIS y:154 , GLN y:156 , SER y:157 , ILE y:161binding site for residue CHL y 605
202AY4SOFTWARELEU y:144 , ILE y:161 , GLN y:165 , MET y:169 , CLA y:604 , CHL y:607binding site for residue CHL y 606
203AY5SOFTWAREALA g:260 , PHE y:132 , LYS y:133 , ALA y:134 , GLY y:135 , SER y:136 , TRP y:162 , CHL y:606binding site for residue CHL y 607
204AY6SOFTWAREARG y:104 , TRP y:105 , VAL y:172 , TYR y:175 , ARG y:176 , GLY y:181 , PRO y:182 , LEU y:183 , GLY y:184 , GLU y:185 , PRO y:192 , PHE y:196 , CLA y:610binding site for residue CHL y 608
205AY7SOFTWARETHR g:82 , CHL g:601 , LEU y:98 , ILE y:101 , TRP y:105 , VAL y:166 , MET y:169 , GLY y:170 , GLU y:173 , CLA y:603binding site for residue CHL y 609
206AY8SOFTWAREARG y:104 , MET y:107 , TYR y:191 , PRO y:192 , GLY y:193 , PHE y:196 , ASP y:197 , PHE y:208 , LEU y:211 , GLU y:215 , ASN y:218 , CHL y:608 , CLA y:612binding site for residue CLA y 610
207AY9SOFTWARETRP y:50 , GLU y:210 , LYS y:214 , LYS y:217 , CHL y:601 , CLA y:612binding site for residue CLA y 611
208AZ1SOFTWAREPHE w:117 , LYS y:214 , ASN y:218 , LEU y:221 , CLA y:610 , CLA y:611binding site for residue CLA y 612
209AZ2SOFTWARESER y:225 , GLY y:228 , GLN y:232 , THR y:236 , ASN y:243 , LEU y:244 , HIS y:247 , ASN y:254 , ASN y:255 , ALA y:256 , CLA y:614binding site for residue CLA y 613
210AZ3SOFTWAREPRO c:206 , TRP n:162 , HIS y:247 , PRO y:251 , CLA y:613binding site for residue CLA y 614
211AZ4SOFTWARELYS 1:57 , TYR 1:58 , TYR 1:78 , TRP 1:80 , CHL 3:309binding site for residue CHL 1 601
212AZ5SOFTWARELEU 1:70 , GLY 1:76 , ASP 1:77 , TYR 1:78 , GLY 1:79 , TRP 1:80 , ASP 1:81 , PHE 1:92 , ASN 1:95 , GLU 1:99 , HIS 1:102 , ARG 1:220 , MET 1:223binding site for residue CLA 1 602
213AZ6SOFTWAREHIS 1:102 , CHL 1:609 , ALA 2:83binding site for residue CLA 1 603
214AZ7SOFTWARELEU 1:108 , GLY 1:112 , PHE 1:115 , GLU 1:128 , GLN 1:137 , LEU 1:144 , TYR 1:146 , LEU 1:147 , CHL 1:606binding site for residue CLA 1 604
215AZ8SOFTWAREPRO 1:150 , SER 1:151 , LEU 1:152 , VAL 1:153 , HIS 1:154 , GLN 1:156 , SER 1:157 , ILE 1:161binding site for residue CHL 1 605
216AZ9SOFTWARELEU 1:144 , GLN 1:165 , CLA 1:604 , CHL 1:607binding site for residue CHL 1 606
217BC1SOFTWAREPHE 1:132 , LYS 1:133 , GLY 1:135 , SER 1:136 , CHL 1:606 , TRP 2:257 , ALA 2:260 , ASN 2:262binding site for residue CHL 1 607
218BC2SOFTWAREARG 1:104 , TRP 1:105 , TYR 1:175 , ARG 1:176 , GLY 1:181 , PRO 1:182 , LEU 1:183 , GLY 1:184 , GLU 1:185 , PRO 1:192 , PHE 1:196 , CLA 1:610binding site for residue CHL 1 608
219BC3SOFTWARELEU 1:98 , TRP 1:105 , MET 1:169 , GLY 1:170 , GLU 1:173 , CLA 1:603 , THR 2:82 , CHL 2:601binding site for residue CHL 1 609
220BC4SOFTWAREARG 1:104 , MET 1:107 , TYR 1:191 , PRO 1:192 , GLY 1:193 , PHE 1:196 , ASP 1:197 , PHE 1:208 , LEU 1:211 , GLU 1:215 , ASN 1:218 , CHL 1:608 , CLA 1:612binding site for residue CLA 1 610
221BC5SOFTWARETRP 1:50 , GLU 1:210 , LYS 1:214 , LYS 1:217 , CLA 1:612binding site for residue CLA 1 611
222BC6SOFTWARELYS 1:214 , ASN 1:218 , LEU 1:221 , CLA 1:610 , CLA 1:611binding site for residue CLA 1 612
223BC7SOFTWAREPHE 1:224 , SER 1:225 , GLY 1:228 , GLN 1:232 , THR 1:236 , ASN 1:243 , LEU 1:244 , HIS 1:247 , ASN 1:254 , ASN 1:255 , ALA 1:256 , CLA 1:614binding site for residue CLA 1 613
224BC8SOFTWAREHIS 1:247 , PRO 1:251 , ASN 1:255 , CLA 1:613 , TRP 3:162binding site for residue CLA 1 614
225BC9SOFTWAREALA 1:260 , ASN 1:262 , PHE 1:263 , PRO 1:265 , PHE 3:132 , LYS 3:133 , CHL 3:307binding site for residue CHL 1 615
226BD1SOFTWARECHL 1:609 , LYS 2:57 , TYR 2:58 , LEU 2:59 , TRP 2:80 , CLA 2:610binding site for residue CHL 2 601
227BD2SOFTWARELEU 2:70 , GLY 2:76 , ASP 2:77 , TYR 2:78 , GLY 2:79 , TRP 2:80 , ASP 2:81 , PHE 2:92 , ASN 2:95 , ARG 2:96 , LEU 2:98 , GLU 2:99 , HIS 2:102 , ARG 2:220binding site for residue CLA 2 602
228BD3SOFTWARELEU 2:98 , HIS 2:102 , CHL 2:608 , ALA 3:83binding site for residue CLA 2 603
229BD4SOFTWARELEU 2:108 , GLY 2:112 , PRO 2:116 , GLN 2:137 , TYR 2:146 , CHL 2:606binding site for residue CLA 2 604
230BD5SOFTWARESER 2:151 , LEU 2:152 , VAL 2:153 , HIS 2:154 , GLN 2:156 , SER 2:157 , ILE 2:161binding site for residue CHL 2 605
231BD6SOFTWARETRP 2:105 , GLN 2:165 , MET 2:169 , CLA 2:604 , CHL 3:301binding site for residue CHL 2 606
232BD7SOFTWAREARG 2:104 , TRP 2:105 , TYR 2:175 , ARG 2:176 , GLY 2:179 , PRO 2:182 , LEU 2:183 , GLY 2:184 , GLU 2:185 , LEU 2:189 , PRO 2:192 , PHE 2:196 , CLA 2:609binding site for residue CHL 2 607
233BD8SOFTWARELEU 2:98 , ILE 2:101 , TRP 2:105 , MET 2:169 , GLY 2:170 , GLU 2:173 , VAL 2:177 , CLA 2:603 , TRP 3:80 , THR 3:82 , CHL 3:302binding site for residue CHL 2 608
234BD9SOFTWAREARG 2:104 , MET 2:107 , TYR 2:191 , PRO 2:192 , GLY 2:193 , PHE 2:196 , ASP 2:197 , PHE 2:208 , LEU 2:211 , GLU 2:215 , ASN 2:218 , CHL 2:607 , CLA 2:611binding site for residue CLA 2 609
235BE1SOFTWARETRP 2:50 , LYS 2:214 , LYS 2:217 , CHL 2:601 , CLA 2:611 , TRP 4:178binding site for residue CLA 2 610
236BE2SOFTWARELYS 2:214 , ASN 2:218 , LEU 2:221 , CLA 2:609 , CLA 2:610binding site for residue CLA 2 611
237BE3SOFTWAREPHE 2:224 , SER 2:225 , GLY 2:228 , GLN 2:232 , THR 2:236 , ASN 2:243 , ASN 2:254 , ASN 2:255 , ALA 2:256 , PHE 2:259 , CLA 2:613binding site for residue CLA 2 612
238BE4SOFTWAREHIS 2:247 , PRO 2:251 , ASN 2:255 , CLA 2:612 , CHL 4:301 , LEU r:275 , PRO r:278binding site for residue CLA 2 613
239BE5SOFTWAREPHE 2:132 , CHL 2:606 , TRP 3:257 , ALA 3:260binding site for residue CHL 3 301
240BE6SOFTWARECHL 2:608 , LYS 3:57 , TYR 3:58 , LEU 3:59 , PRO 3:61 , TRP 3:80 , CLA 3:311binding site for residue CHL 3 302
241BE7SOFTWARELEU 3:70 , GLY 3:76 , ASP 3:77 , TYR 3:78 , GLY 3:79 , TRP 3:80 , ASP 3:81 , PHE 3:92 , ASN 3:95 , GLU 3:99 , HIS 3:102 , ARG 3:220binding site for residue CLA 3 303
242BE8SOFTWARELEU 3:98 , HIS 3:102 , CHL 3:309binding site for residue CLA 3 304
243BE9SOFTWARELEU 3:108 , GLY 3:112 , PRO 3:116 , ALA 3:134 , GLN 3:137 , CHL 3:307binding site for residue CLA 3 305
244BF1SOFTWAREPRO 3:150 , SER 3:151 , LEU 3:152 , VAL 3:153 , HIS 3:154 , GLN 3:156 , SER 3:157 , ILE 3:161binding site for residue CHL 3 306
245BF2SOFTWARECHL 1:615 , GLN 3:165 , MET 3:169 , CLA 3:305 , CHL 3:309binding site for residue CHL 3 307
246BF3SOFTWAREARG 3:104 , TRP 3:105 , TYR 3:175 , ARG 3:176 , LEU 3:183 , GLY 3:184 , GLU 3:185 , LEU 3:189 , LEU 3:190 , PRO 3:192 , PHE 3:196 , CLA 3:310binding site for residue CHL 3 308
247BF4SOFTWARETRP 1:80 , THR 1:82 , CHL 1:601 , GLU 3:97 , LEU 3:98 , ILE 3:101 , TRP 3:105 , MET 3:169 , GLY 3:170 , GLU 3:173 , CLA 3:304 , CHL 3:307binding site for residue CHL 3 309
248BF5SOFTWAREARG 3:104 , MET 3:107 , TYR 3:191 , PRO 3:192 , GLY 3:193 , PHE 3:196 , ASP 3:197 , PHE 3:208 , LEU 3:211 , GLU 3:215 , ASN 3:218 , CHL 3:308 , CLA 3:312binding site for residue CLA 3 310
249BF6SOFTWARETRP 3:50 , LYS 3:214 , LYS 3:217 , CHL 3:302 , CLA 3:312binding site for residue CLA 3 311
250BF7SOFTWARELYS 3:214 , ASN 3:218 , LEU 3:221 , CLA 3:310 , CLA 3:311binding site for residue CLA 3 312
251BF8SOFTWARESER 3:225 , GLY 3:228 , GLN 3:232 , THR 3:236 , ASN 3:243 , HIS 3:247 , ASN 3:254 , ASN 3:255 , ALA 3:256 , PHE 3:259 , CLA 3:314binding site for residue CLA 3 313
252BF9SOFTWARELEU 2:159 , TRP 2:162 , HIS 3:247 , PRO 3:251 , ASN 3:255 , TRP 3:257 , CLA 3:313binding site for residue CLA 3 314
253BG1SOFTWARELEU 4:73 , LEU 4:77 , PRO 4:78 , GLY 4:79 , ASP 4:80 , PHE 4:81 , GLY 4:82 , PHE 4:83 , ASP 4:84 , TYR 4:98 , ARG 4:99 , ALA 4:101 , GLU 4:102 , HIS 4:105 , ARG 4:233binding site for residue CLA 4 302
254BG2SOFTWARETRP 4:97 , TYR 4:98 , ALA 4:101 , HIS 4:105 , TRP 4:108 , MET 4:239 , CHL 4:308binding site for residue CLA 4 303
255BG3SOFTWAREALA 4:111 , ALA 4:112 , GLY 4:115 , VAL 4:118 , GLY 4:119 , PHE 4:128 , ALA 4:132 , GLN 4:133 , CHL 4:305binding site for residue CLA 4 304
256BG4SOFTWARETRP 4:108 , ALA 4:136 , GLN 4:149 , CLA 4:304 , CHL 4:306 , CHL 4:308binding site for residue CHL 4 305
257BG5SOFTWARELEU 4:146 , CHL 4:305binding site for residue CHL 4 306
258BG6SOFTWAREARG 4:107 , VAL 4:156 , LYS 4:159 , ARG 4:160 , ASP 4:163 , GLN 4:170 , ALA 4:182 , ASN 4:184 , GLN 4:192 , PHE 4:200binding site for residue CHL 4 307
259BG7SOFTWARETRP 4:97 , ILE 4:104 , HIS 4:105 , TRP 4:108 , LEU 4:150 , MET 4:153 , GLY 4:154 , GLU 4:157 , ARG 4:160 , TRP 4:161 , CLA 4:303 , CHL 4:305binding site for residue CHL 4 308
260BG8SOFTWAREARG 4:107 , MET 4:110 , TYR 4:188 , TYR 4:194 , PRO 4:195 , GLY 4:196 , PHE 4:200 , ASP 4:201 , LEU 4:205 , LEU 4:224 , GLU 4:228 , CLA 4:310binding site for residue CLA 4 309
261BG9SOFTWAREARG 4:223 , LEU 4:224 , HIS 4:231 , LEU 4:234 , CLA 4:309binding site for residue CLA 4 310
262BH1SOFTWARELYS 5:57 , TYR 5:58 , TYR 5:78 , TRP 5:80 , CHL 7:309binding site for residue CHL 5 601
263BH2SOFTWARELEU 5:70 , GLY 5:76 , ASP 5:77 , TYR 5:78 , GLY 5:79 , TRP 5:80 , ASP 5:81 , PHE 5:92 , ASN 5:95 , GLU 5:99 , HIS 5:102 , ARG 5:220 , MET 5:223binding site for residue CLA 5 602
264BH3SOFTWAREHIS 5:102 , CHL 5:609 , ALA 6:83binding site for residue CLA 5 603
265BH4SOFTWARELEU 5:108 , GLY 5:112 , PHE 5:115 , GLU 5:128 , GLN 5:137 , LEU 5:144 , TYR 5:146 , LEU 5:147 , CHL 5:606binding site for residue CLA 5 604
266BH5SOFTWAREPRO 5:150 , SER 5:151 , LEU 5:152 , VAL 5:153 , HIS 5:154 , GLN 5:156 , SER 5:157 , ILE 5:161binding site for residue CHL 5 605
267BH6SOFTWARELEU 5:144 , GLN 5:165 , CLA 5:604 , CHL 5:607binding site for residue CHL 5 606
268BH7SOFTWAREPHE 5:132 , LYS 5:133 , GLY 5:135 , SER 5:136 , CHL 5:606 , TRP 6:257 , ALA 6:260 , ASN 6:262binding site for residue CHL 5 607
269BH8SOFTWAREARG 5:104 , TRP 5:105 , TYR 5:175 , ARG 5:176 , GLY 5:181 , PRO 5:182 , LEU 5:183 , GLY 5:184 , GLU 5:185 , PRO 5:192 , PHE 5:196 , CLA 5:610binding site for residue CHL 5 608
270BH9SOFTWARELEU 5:98 , TRP 5:105 , MET 5:169 , GLY 5:170 , GLU 5:173 , CLA 5:603 , THR 6:82 , CHL 6:601binding site for residue CHL 5 609
271BI1SOFTWAREARG 5:104 , MET 5:107 , TYR 5:191 , PRO 5:192 , GLY 5:193 , PHE 5:196 , ASP 5:197 , PHE 5:208 , LEU 5:211 , GLU 5:215 , ASN 5:218 , CHL 5:608 , CLA 5:612binding site for residue CLA 5 610
272BI2SOFTWARETRP 5:50 , GLU 5:210 , LYS 5:214 , LYS 5:217 , CLA 5:612binding site for residue CLA 5 611
273BI3SOFTWARELYS 5:214 , ASN 5:218 , LEU 5:221 , CLA 5:610 , CLA 5:611binding site for residue CLA 5 612
274BI4SOFTWAREPHE 5:224 , SER 5:225 , GLY 5:228 , GLN 5:232 , THR 5:236 , ASN 5:243 , LEU 5:244 , HIS 5:247 , ASN 5:254 , ASN 5:255 , ALA 5:256 , CLA 5:614binding site for residue CLA 5 613
275BI5SOFTWAREHIS 5:247 , PRO 5:251 , ASN 5:255 , CLA 5:613 , TRP 7:162binding site for residue CLA 5 614
276BI6SOFTWAREALA 5:260 , ASN 5:262 , PHE 5:263 , PRO 5:265 , PHE 7:132 , LYS 7:133 , CHL 7:307binding site for residue CHL 5 615
277BI7SOFTWARECHL 5:609 , LYS 6:57 , TYR 6:58 , LEU 6:59 , TRP 6:80 , CLA 6:610binding site for residue CHL 6 601
278BI8SOFTWARELEU 6:70 , GLY 6:76 , ASP 6:77 , TYR 6:78 , GLY 6:79 , TRP 6:80 , ASP 6:81 , PHE 6:92 , ASN 6:95 , ARG 6:96 , LEU 6:98 , GLU 6:99 , HIS 6:102 , ARG 6:220binding site for residue CLA 6 602
279BI9SOFTWARELEU 6:98 , HIS 6:102 , CHL 6:608 , ALA 7:83binding site for residue CLA 6 603
280BJ1SOFTWARELEU 6:108 , GLY 6:112 , PRO 6:116 , GLN 6:137 , TYR 6:146 , CHL 6:606binding site for residue CLA 6 604
281BJ2SOFTWARESER 6:151 , LEU 6:152 , VAL 6:153 , HIS 6:154 , GLN 6:156 , SER 6:157 , ILE 6:161binding site for residue CHL 6 605
282BJ3SOFTWARETRP 6:105 , GLN 6:165 , MET 6:169 , CLA 6:604 , CHL 7:301binding site for residue CHL 6 606
283BJ4SOFTWAREARG 6:104 , TRP 6:105 , TYR 6:175 , ARG 6:176 , GLY 6:179 , PRO 6:182 , LEU 6:183 , GLY 6:184 , GLU 6:185 , LEU 6:189 , PRO 6:192 , PHE 6:196 , CLA 6:609binding site for residue CHL 6 607
284BJ5SOFTWARELEU 6:98 , ILE 6:101 , TRP 6:105 , MET 6:169 , GLY 6:170 , GLU 6:173 , VAL 6:177 , CLA 6:603 , TRP 7:80 , THR 7:82 , CHL 7:302binding site for residue CHL 6 608
285BJ6SOFTWAREARG 6:104 , MET 6:107 , TYR 6:191 , PRO 6:192 , GLY 6:193 , PHE 6:196 , ASP 6:197 , PHE 6:208 , LEU 6:211 , GLU 6:215 , ASN 6:218 , CHL 6:607 , CLA 6:611binding site for residue CLA 6 609
286BJ7SOFTWARETRP 6:50 , LYS 6:214 , LYS 6:217 , CHL 6:601 , CLA 6:611 , TRP 8:178binding site for residue CLA 6 610
287BJ8SOFTWARELYS 6:214 , ASN 6:218 , LEU 6:221 , CLA 6:609 , CLA 6:610binding site for residue CLA 6 611
288BJ9SOFTWAREPHE 6:224 , SER 6:225 , GLY 6:228 , GLN 6:232 , THR 6:236 , ASN 6:243 , ASN 6:254 , ASN 6:255 , ALA 6:256 , PHE 6:259 , CLA 6:613binding site for residue CLA 6 612
289BK1SOFTWAREHIS 6:247 , PRO 6:251 , ASN 6:255 , CLA 6:612 , CHL 8:301 , LEU R:275 , PRO R:278binding site for residue CLA 6 613
290BK2SOFTWAREPHE 6:132 , CHL 6:606 , TRP 7:257 , ALA 7:260binding site for residue CHL 7 301
291BK3SOFTWARECHL 6:608 , LYS 7:57 , TYR 7:58 , LEU 7:59 , PRO 7:61 , TRP 7:80 , CLA 7:311binding site for residue CHL 7 302
292BK4SOFTWARELEU 7:70 , GLY 7:76 , ASP 7:77 , TYR 7:78 , GLY 7:79 , TRP 7:80 , ASP 7:81 , PHE 7:92 , ASN 7:95 , GLU 7:99 , HIS 7:102 , ARG 7:220binding site for residue CLA 7 303
293BK5SOFTWARELEU 7:98 , HIS 7:102 , CHL 7:309binding site for residue CLA 7 304
294BK6SOFTWARELEU 7:108 , GLY 7:112 , PRO 7:116 , ALA 7:134 , GLN 7:137 , CHL 7:307binding site for residue CLA 7 305
295BK7SOFTWAREPRO 7:150 , SER 7:151 , LEU 7:152 , VAL 7:153 , HIS 7:154 , GLN 7:156 , SER 7:157 , ILE 7:161binding site for residue CHL 7 306
296BK8SOFTWARECHL 5:615 , GLN 7:165 , MET 7:169 , CLA 7:305 , CHL 7:309binding site for residue CHL 7 307
297BK9SOFTWAREARG 7:104 , TRP 7:105 , TYR 7:175 , ARG 7:176 , LEU 7:183 , GLY 7:184 , GLU 7:185 , LEU 7:189 , LEU 7:190 , PRO 7:192 , PHE 7:196 , CLA 7:310binding site for residue CHL 7 308
298BL1SOFTWARETRP 5:80 , THR 5:82 , CHL 5:601 , GLU 7:97 , LEU 7:98 , ILE 7:101 , TRP 7:105 , MET 7:169 , GLY 7:170 , GLU 7:173 , CLA 7:304 , CHL 7:307binding site for residue CHL 7 309
299BL2SOFTWAREARG 7:104 , MET 7:107 , TYR 7:191 , PRO 7:192 , GLY 7:193 , PHE 7:196 , ASP 7:197 , PHE 7:208 , LEU 7:211 , GLU 7:215 , ASN 7:218 , CHL 7:308 , CLA 7:312binding site for residue CLA 7 310
300BL3SOFTWARETRP 7:50 , LYS 7:214 , LYS 7:217 , CHL 7:302 , CLA 7:312binding site for residue CLA 7 311
301BL4SOFTWARELYS 7:214 , ASN 7:218 , LEU 7:221 , CLA 7:310 , CLA 7:311binding site for residue CLA 7 312
302BL5SOFTWARESER 7:225 , GLY 7:228 , GLN 7:232 , THR 7:236 , ASN 7:243 , HIS 7:247 , ASN 7:254 , ASN 7:255 , ALA 7:256 , PHE 7:259 , CLA 7:314binding site for residue CLA 7 313
303BL6SOFTWARELEU 6:159 , TRP 6:162 , HIS 7:247 , PRO 7:251 , ASN 7:255 , TRP 7:257 , CLA 7:313binding site for residue CLA 7 314
304BL7SOFTWARELEU 8:73 , LEU 8:77 , PRO 8:78 , GLY 8:79 , ASP 8:80 , PHE 8:81 , GLY 8:82 , PHE 8:83 , ASP 8:84 , TYR 8:98 , ARG 8:99 , ALA 8:101 , GLU 8:102 , HIS 8:105 , ARG 8:233binding site for residue CLA 8 302
305BL8SOFTWARETRP 8:97 , TYR 8:98 , ALA 8:101 , HIS 8:105 , TRP 8:108 , MET 8:239 , CHL 8:308binding site for residue CLA 8 303
306BL9SOFTWAREALA 8:111 , ALA 8:112 , GLY 8:115 , VAL 8:118 , GLY 8:119 , PHE 8:128 , ALA 8:132 , GLN 8:133 , CHL 8:305binding site for residue CLA 8 304
307BM1SOFTWARETRP 8:108 , ALA 8:136 , GLN 8:149 , CLA 8:304 , CHL 8:306 , CHL 8:308binding site for residue CHL 8 305
308BM2SOFTWARELEU 8:146 , CHL 8:305binding site for residue CHL 8 306
309BM3SOFTWAREARG 8:107 , VAL 8:156 , LYS 8:159 , ARG 8:160 , ASP 8:163 , GLN 8:170 , ALA 8:182 , ASN 8:184 , GLN 8:192 , PHE 8:200binding site for residue CHL 8 307
310BM4SOFTWARETRP 8:97 , ILE 8:104 , HIS 8:105 , TRP 8:108 , LEU 8:150 , MET 8:153 , GLY 8:154 , GLU 8:157 , ARG 8:160 , TRP 8:161 , CLA 8:303 , CHL 8:305binding site for residue CHL 8 308
311BM5SOFTWAREARG 8:107 , MET 8:110 , TYR 8:188 , TYR 8:194 , PRO 8:195 , GLY 8:196 , PHE 8:200 , ASP 8:201 , LEU 8:205 , LEU 8:224 , GLU 8:228 , CLA 8:310binding site for residue CLA 8 309
312BM6SOFTWAREARG 8:223 , LEU 8:224 , HIS 8:231 , LEU 8:234 , CLA 8:309binding site for residue CLA 8 310
313BM7SOFTWAREPHE 4:140 , SER 4:141 , PHE 4:142 , GLY 4:143 , SER 4:144 , HIS r:280 , THR r:282 , ILE r:283 , ILE r:284 , THR r:286binding site for Ligand ASP r 285 bound to SER 4 141
314BM8SOFTWARESER 4:141 , SER 4:144 , LEU 4:146 , GLY 4:147 , THR 4:148 , GLN 4:149 , GLU r:138 , CYS r:139 , GLU r:140 , LEU r:141 , GLY r:144 , TRP r:146 , ALA r:147 , MET r:148 , LEU r:149 , LEU r:216 , TYR r:217 , GLU r:242 , THR r:282 , ILE r:283 , ASP r:285 , THR r:286 , SER r:288 , CLA r:302 , CHL r:306 , CLA r:307 , CLA r:308binding site for Ligand residues ILE r 284 through LEU 4 145 bound to SER 4 144
315BM9SOFTWARESER 4:141 , PHE 4:142 , GLY 4:143 , SER 4:144 , LEU 4:145 , LEU 4:146 , THR r:282 , ILE r:283 , ASP r:285 , THR r:286 , SER r:288binding site for Ligand ILE r 284 bound to SER 4 144
316BN1SOFTWARESER 4:141 , PHE 4:142 , GLY 4:143 , SER 4:144 , LEU 4:145 , LEU 4:146 , THR r:282 , ILE r:283 , ASP r:285 , THR r:286 , SER r:288binding site for Ligand ILE r 284 bound to SER 4 144
317BN2SOFTWARESER 4:141 , PHE 4:142 , GLY 4:143 , SER 4:144 , LEU 4:145 , LEU 4:146 , THR r:282 , ILE r:283 , ASP r:285 , THR r:286 , SER r:288binding site for Ligand ILE r 284 bound to SER 4 144
318BN3SOFTWAREPHE 8:140 , SER 8:141 , PHE 8:142 , GLY 8:143 , SER 8:144 , HIS R:280 , THR R:282 , ILE R:283 , ILE R:284 , THR R:286binding site for Ligand ASP R 285 bound to SER 8 141
319BN4SOFTWARESER 8:141 , SER 8:144 , LEU 8:146 , GLY 8:147 , THR 8:148 , GLN 8:149 , GLU R:138 , CYS R:139 , GLU R:140 , LEU R:141 , GLY R:144 , TRP R:146 , ALA R:147 , MET R:148 , LEU R:149 , LEU R:216 , TYR R:217 , GLU R:242 , THR R:282 , ILE R:283 , ASP R:285 , THR R:286 , SER R:288 , CLA R:302 , CHL R:306 , CLA R:307 , CLA R:308binding site for Ligand residues ILE R 284 through LEU 8 145 bound to SER 8 144
320BN5SOFTWARESER 8:141 , PHE 8:142 , GLY 8:143 , SER 8:144 , LEU 8:145 , LEU 8:146 , THR R:282 , ILE R:283 , ASP R:285 , THR R:286 , SER R:288binding site for Ligand ILE R 284 bound to SER 8 144
321BN6SOFTWARESER 8:141 , PHE 8:142 , GLY 8:143 , SER 8:144 , LEU 8:145 , LEU 8:146 , THR R:282 , ILE R:283 , ASP R:285 , THR R:286 , SER R:288binding site for Ligand ILE R 284 bound to SER 8 144
322BN7SOFTWARESER 8:141 , PHE 8:142 , GLY 8:143 , SER 8:144 , LEU 8:145 , LEU 8:146 , THR R:282 , ILE R:283 , ASP R:285 , THR R:286 , SER R:288binding site for Ligand ILE R 284 bound to SER 8 144
323BN8SOFTWAREALA 4:138 , PHE 4:140 , SER 4:141 , ARG r:135 , PHE r:136 , ARG r:137 , GLU r:138 , GLU r:140 , LEU r:141 , HIS r:143 , ASP r:277 , PRO r:278 , LEU r:279 , THR r:281 , THR r:282 , ASP r:285 , CLA r:302binding site for Di-peptide PRO 4 139 and HIS r 280
324BN9SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
325BO1SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
326BO2SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
327BO3SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
328BO4SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
329BO5SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
330BO6SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , HIS r:280 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and LEU r 279
331BO7SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , LEU r:279 , THR r:281 , THR r:282 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and HIS r 280
332BO8SOFTWAREALA 4:138 , PRO 4:139 , SER 4:141 , PHE r:136 , ARG r:137 , GLU r:138 , CYS r:139 , LEU r:141 , ILE r:142 , GLY r:144 , ARG r:247 , ASP r:277 , PRO r:278 , LEU r:279 , THR r:281 , THR r:282 , ASP r:285 , CLA r:301binding site for Di-peptide PHE 4 140 and HIS r 280
333BO9SOFTWAREASN 4:187 , LEU 4:205 , ALA 4:206 , ASN 4:209 , ASP 4:217 , PHE 4:218binding site for Di-peptide GLY 4 207 and LYS 4 208
334BP1SOFTWARECLA 2:613 , SER 4:144 , LEU 4:145 , LEU 4:146 , GLY 4:147 , GLN 4:149 , LEU 4:150 , LEU 4:151 , LEU 4:152 , TRP r:271 , HIS r:274 , LEU r:275 , PRO r:278 , THR r:282 , CLA r:311binding site for Di-peptide CHL 4 301 and THR 4 148
335BP2SOFTWAREALA 8:138 , PHE 8:140 , SER 8:141 , ARG R:135 , PHE R:136 , ARG R:137 , GLU R:138 , GLU R:140 , LEU R:141 , HIS R:143 , ASP R:277 , PRO R:278 , LEU R:279 , THR R:281 , THR R:282 , ASP R:285 , CLA R:302binding site for Di-peptide PRO 8 139 and HIS R 280
336BP3SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
337BP4SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
338BP5SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
339BP6SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
340BP7SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
341BP8SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
342BP9SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , LEU R:279 , THR R:281 , THR R:282 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and HIS R 280
343BQ1SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , HIS R:280 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and LEU R 279
344BQ2SOFTWAREALA 8:138 , PRO 8:139 , SER 8:141 , PHE R:136 , ARG R:137 , GLU R:138 , CYS R:139 , LEU R:141 , ILE R:142 , GLY R:144 , ARG R:247 , ASP R:277 , PRO R:278 , LEU R:279 , THR R:281 , THR R:282 , ASP R:285 , CLA R:301binding site for Di-peptide PHE 8 140 and HIS R 280
345BQ3SOFTWAREASN 8:187 , LEU 8:205 , ALA 8:206 , ASN 8:209 , ASP 8:217 , PHE 8:218binding site for Di-peptide GLY 8 207 and LYS 8 208
346BQ4SOFTWARECLA 6:613 , SER 8:144 , LEU 8:145 , LEU 8:146 , GLY 8:147 , GLN 8:149 , LEU 8:150 , LEU 8:151 , LEU 8:152 , TRP R:271 , HIS R:274 , LEU R:275 , PRO R:278 , THR R:282 , CLA R:311binding site for Di-peptide CHL 8 301 and THR 8 148
347BQ5SOFTWARETRP 8:57 , ILE 8:58 , ALA 8:60 , VAL 8:61 , GLY 8:63 , GLY 8:82 , SER 8:169 , GLN 8:170 , VAL 8:172 , TRP 8:174 , ALA 8:175 , LEU R:57 , TRP R:58 , PRO R:60 , GLY R:61 , GLY R:169 , LYS R:170 , VAL R:171 , GLU R:172 , VAL R:174 , ASP R:175 , CHL R:305 , CLA R:312binding site for Di-peptide TYR R 59 and GLU 8 173
348BQ6SOFTWARETRP 8:57 , ILE 8:58 , ALA 8:60 , VAL 8:61 , GLY 8:63 , GLY 8:82 , LYS 8:159 , SER 8:169 , SER 8:171 , GLU 8:173 , SER 8:179 , ALA 8:182 , CHL 8:307 , LEU R:57 , TRP R:58 , PRO R:60 , GLY R:61 , ASP R:167 , ALA R:168 , GLY R:169 , VAL R:171 , GLU R:172 , LEU R:173 , VAL R:174 , CHL R:305 , CLA R:312binding site for Di-peptide TYR R 59 and GLN 8 170
349BQ7SOFTWARETRP 8:155 , LYS 8:159 , VAL 8:162 , VAL 8:172 , TRP 8:174 , ALA 8:175 , LEU R:57 , TRP R:58 , TYR R:59 , GLY R:169 , LYS R:170 , VAL R:171 , GLU R:172 , VAL R:174 , ASP R:175 , CHL R:305binding site for Di-peptide CLA R 312 and GLU 8 173
350BQ8SOFTWARETRP 4:57 , ILE 4:58 , ALA 4:60 , VAL 4:61 , GLY 4:63 , GLY 4:82 , LYS 4:159 , SER 4:169 , SER 4:171 , GLU 4:173 , SER 4:179 , ALA 4:182 , CHL 4:307 , LEU r:57 , TRP r:58 , PRO r:60 , GLY r:61 , ASP r:167 , ALA r:168 , GLY r:169 , VAL r:171 , GLU r:172 , LEU r:173 , VAL r:174 , CHL r:305 , CLA r:312binding site for Di-peptide TYR r 59 and GLN 4 170
351BQ9SOFTWARETRP 4:57 , ILE 4:58 , ALA 4:60 , VAL 4:61 , GLY 4:63 , GLY 4:82 , SER 4:169 , GLN 4:170 , VAL 4:172 , TRP 4:174 , ALA 4:175 , LEU r:57 , TRP r:58 , PRO r:60 , GLY r:61 , GLY r:169 , LYS r:170 , VAL r:171 , GLU r:172 , VAL r:174 , ASP r:175 , CHL r:305 , CLA r:312binding site for Di-peptide TYR r 59 and GLU 4 173
352BR1SOFTWARETRP 4:155 , LYS 4:159 , VAL 4:162 , VAL 4:172 , TRP 4:174 , ALA 4:175 , LEU r:57 , TRP r:58 , TYR r:59 , GLY r:169 , LYS r:170 , VAL r:171 , GLU r:172 , VAL r:174 , ASP r:175 , CHL r:305binding site for Di-peptide CLA r 312 and GLU 4 173

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1O:114 -O:137
2o:114 -o:137

(-) Cis Peptide Bonds  (10, 10)

Asymmetric/Biological Unit
No.Residues
1Asp O:118 -Gly O:119
2Asp O:192 -Gly O:193
3Asp o:118 -Gly o:119
4Asp o:192 -Gly o:193
5Gly S:142 -Pro S:143
6Ile S:167 -Pro S:168
7Asp S:214 -Pro S:215
8Gly s:142 -Pro s:143
9Ile s:167 -Pro s:168
10Asp s:214 -Pro s:215

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MDX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MDX)

(-) Exons   (0, 0)

(no "Exon" information available for 5MDX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 1 from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx 1  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain 2 from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx 2  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain 3 from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx 3  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain 4 from PDB  Type:PROTEIN  Length:204
                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhh...hhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh....................hhhhh...........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mdx 4  54 KKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGVAWFEAGAQPDAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAENFANYTGDQGYPGGRFFDPLGLAGKNRDGVYEPDFEKLERLKLAEIKHSRLAMVAMLIFYFEAGQGKTPLGALG 257
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253    

Chain 5 from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx 5  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain 6 from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx 6  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain 7 from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.............hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx 7  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain 8 from PDB  Type:PROTEIN  Length:204
                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhh...hhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhh....................hhhhh...........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mdx 8  54 KKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGVAWFEAGAQPDAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAENFANYTGDQGYPGGRFFDPLGLAGKNRDGVYEPDFEKLERLKLAEIKHSRLAMVAMLIFYFEAGQGKTPLGALG 257
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253    

Chain A from PDB  Type:PROTEIN  Length:308
                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh...............hhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx A  11 ESLLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFP 340
                              ||    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332        
                             13|                                                                                                                                                                                                                                                                                                                
                              36                                                                                                                                                                                                                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:478
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhh.........eee........eee...............hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.................eeeee.....ee.....ee.............eeee.....eeeee.........hhhhhh.eee..hhhhh..ee.hhhhhhhhhhhhhh...eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx B   2 GLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVF 479
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471        

Chain C from PDB  Type:PROTEIN  Length:433
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhhhhhhhhhhhh.....eee.......eee.......hhhhhhhhhh........hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhh...............eee.....eee.hhhhhhh.....hhhhhee..ee..hhhhhh.hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx C  24 AGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGGDVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPVNYVSPRSWLSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPL 472
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393      |419       429       439       449       459       469   
                                                                                                                                                                                                                                                                                                                                                                                                                  400|                                                       
                                                                                                                                                                                                                                                                                                                                                                                                                   417                                                       

Chain D from PDB  Type:PROTEIN  Length:336
                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhh...hhhhh......ee...hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mdx D  16 FDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGN 351
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345      

Chain E from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhh..hh.hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...............hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 5mdx E  10 FADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSR  81
                                    19        29        39        49        59        69        79  

Chain F from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5mdx F  11 TVRWLAVHGLAVPTVSFLGSISAMQFIQR  39
                                    20        30         

Chain G from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx G  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain H from PDB  Type:PROTEIN  Length:52
                                                                                    
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                 5mdx H  14 PRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSV  65
                                    23        33        43        53        63  

Chain I from PDB  Type:PROTEIN  Length:35
                                                                   
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 5mdx I   1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRE  35
                                    10        20        30     

Chain K from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5mdx K  25 KLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVSF  60
                                    34        44        54      

Chain L from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5mdx L   3 QSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN  38
                                    12        22        32      

Chain M from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5mdx M   4 NILAFIATALFILVPTAFLLIIYVKTVSQ  32
                                    13        23         

Chain N from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx N  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain O from PDB  Type:PROTEIN  Length:193
                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.........................eeeeeeeeeeeeeee...eee.ee............ee...................eeeeee.hhh.eeeeee.............eeeeeee......eeeeeeeeeee......eeeeeeeeeee...........eeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx O  91 RLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 332
                                   100       110       120       130       140      |158       168       178       188       198       208       218       228       238|      289       299       309       319       329   
                                                                                  147|                                                                               238|                                                    
                                                                                   156                                                                                280                                                    

Chain R from PDB  Type:PROTEIN  Length:188
                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................................hhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh.eee..eee..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhh.hhhhhh..hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.....hhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx R  56 PLWYPGAISPDWLDGSLVGDYGFDPFGLGKPGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFS 288
                                    65        75        85||     140       150       160       170       180       190       200       210       220       230       240       250       260       270       280        
                                                         86|                                                                                                                                                            
                                                         132                                                                                                                                                            

Chain S from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhh................hhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx S  59 LAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAG 272
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268    

Chain T from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5mdx T   1 MEALVYTFLLVSTLGIIFFAIFFREPPKI  29
                                    10        20         

Chain W from PDB  Type:PROTEIN  Length:46
                                                                              
               SCOP domains ---------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                 5mdx W  83 ERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEE 128
                                    92       102       112       122      

Chain X from PDB  Type:PROTEIN  Length:32
                                                                
               SCOP domains -------------------------------- SCOP domains
               CATH domains -------------------------------- CATH domains
               Pfam domains -------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------- PROSITE
                 Transcript -------------------------------- Transcript
                 5mdx X  80 SPSLKNFLLSIASGGLVLTVIIGVVVGVSNFD 111
                                    89        99       109  

Chain Y from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx Y  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain Z from PDB  Type:PROTEIN  Length:61
                                                                                             
               SCOP domains ------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------- Transcript
                 5mdx Z   1 MTIAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLI  61
                                    10        20        30        40        50        60 

Chain a from PDB  Type:PROTEIN  Length:330
                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mdx a  11 ESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFP 340
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340

Chain b from PDB  Type:PROTEIN  Length:478
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhh.........eee........eee...............hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.................eeeee.....ee.....ee.............eeee.....eeeee.........hhhhhh.eee..hhhhh..ee.hhhhhhhhhhhhhh...eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx b   2 GLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVF 479
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471        

Chain c from PDB  Type:PROTEIN  Length:433
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhhhhhhhhhhhh.....eee.......eee.......hhhhhhhhhh........hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhh...............eee.....eee.hhhhhhh.....hhhhhee..ee..hhhhhh.hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx c  24 AGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGGDVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPVNYVSPRSWLSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPL 472
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393      |419       429       439       449       459       469   
                                                                                                                                                                                                                                                                                                                                                                                                                  400|                                                       
                                                                                                                                                                                                                                                                                                                                                                                                                   417                                                       

Chain d from PDB  Type:PROTEIN  Length:336
                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhh...hhhhh......ee...hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mdx d  16 FDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGN 351
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345      

Chain e from PDB  Type:PROTEIN  Length:72
                                                                                                        
               SCOP domains ------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhh..hh.hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...............hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------ Transcript
                 5mdx e  10 FADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSR  81
                                    19        29        39        49        59        69        79  

Chain f from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5mdx f  11 TVRWLAVHGLAVPTVSFLGSISAMQFIQR  39
                                    20        30         

Chain g from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx g  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain h from PDB  Type:PROTEIN  Length:52
                                                                                    
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                 5mdx h  14 PRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSV  65
                                    23        33        43        53        63  

Chain i from PDB  Type:PROTEIN  Length:35
                                                                   
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 5mdx i   1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRE  35
                                    10        20        30     

Chain k from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5mdx k  25 KLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVSF  60
                                    34        44        54      

Chain l from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5mdx l   3 QSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN  38
                                    12        22        32      

Chain m from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5mdx m   4 NILAFIATALFILVPTAFLLIIYVKTVSQ  32
                                    13        23         

Chain n from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx n  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain o from PDB  Type:PROTEIN  Length:193
                                                                                                                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.........................eeeeeeeeeeeeeee...eee.ee............ee...................eeeeee.hhh.eeeeee.............eeeeeee......eeeeeeeeeee......eeeeeeeeeee...........eeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx o  91 RLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 332
                                   100       110       120       130       140      |158       168       178       188       198       208       218       228       238|      289       299       309       319       329   
                                                                                  147|                                                                               238|                                                    
                                                                                   156                                                                                280                                                    

Chain r from PDB  Type:PROTEIN  Length:188
                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................................hhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh.eee..eee..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhh.hhhhhh..hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.....hhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx r  56 PLWYPGAISPDWLDGSLVGDYGFDPFGLGKPGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFS 288
                                    65        75        85||     140       150       160       170       180       190       200       210       220       230       240       250       260       270       280        
                                                         86|                                                                                                                                                            
                                                         132                                                                                                                                                            

Chain s from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhh................hhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh.....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx s  59 LAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAG 272
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268    

Chain t from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5mdx t   1 MEALVYTFLLVSTLGIIFFAIFFREPPKI  29
                                    10        20         

Chain w from PDB  Type:PROTEIN  Length:46
                                                                              
               SCOP domains ---------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                 5mdx w  83 ERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEE 128
                                    92       102       112       122      

Chain x from PDB  Type:PROTEIN  Length:32
                                                                
               SCOP domains -------------------------------- SCOP domains
               CATH domains -------------------------------- CATH domains
               Pfam domains -------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------- PROSITE
                 Transcript -------------------------------- Transcript
                 5mdx x  80 SPSLKNFLLSIASGGLVLTVIIGVVVGVSNFD 111
                                    89        99       109  

Chain y from PDB  Type:PROTEIN  Length:219
                                                                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhh.......hhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh....hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mdx y  48 SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPG 266
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257         

Chain z from PDB  Type:PROTEIN  Length:61
                                                                                             
               SCOP domains ------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------- Transcript
                 5mdx z   1 MTIAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLI  61
                                    10        20        30        40        50        60 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MDX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MDX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MDX)

(-) Gene Ontology  (57, 292)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CHL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PHO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
    AH4  [ RasMol ]  +environment [ RasMol ]
    AH5  [ RasMol ]  +environment [ RasMol ]
    AH6  [ RasMol ]  +environment [ RasMol ]
    AH7  [ RasMol ]  +environment [ RasMol ]
    AH8  [ RasMol ]  +environment [ RasMol ]
    AH9  [ RasMol ]  +environment [ RasMol ]
    AI1  [ RasMol ]  +environment [ RasMol ]
    AI2  [ RasMol ]  +environment [ RasMol ]
    AI3  [ RasMol ]  +environment [ RasMol ]
    AI4  [ RasMol ]  +environment [ RasMol ]
    AI5  [ RasMol ]  +environment [ RasMol ]
    AI6  [ RasMol ]  +environment [ RasMol ]
    AI7  [ RasMol ]  +environment [ RasMol ]
    AI8  [ RasMol ]  +environment [ RasMol ]
    AI9  [ RasMol ]  +environment [ RasMol ]
    AJ1  [ RasMol ]  +environment [ RasMol ]
    AJ2  [ RasMol ]  +environment [ RasMol ]
    AJ3  [ RasMol ]  +environment [ RasMol ]
    AJ4  [ RasMol ]  +environment [ RasMol ]
    AJ5  [ RasMol ]  +environment [ RasMol ]
    AJ6  [ RasMol ]  +environment [ RasMol ]
    AJ7  [ RasMol ]  +environment [ RasMol ]
    AJ8  [ RasMol ]  +environment [ RasMol ]
    AJ9  [ RasMol ]  +environment [ RasMol ]
    AK1  [ RasMol ]  +environment [ RasMol ]
    AK2  [ RasMol ]  +environment [ RasMol ]
    AK3  [ RasMol ]  +environment [ RasMol ]
    AK4  [ RasMol ]  +environment [ RasMol ]
    AK5  [ RasMol ]  +environment [ RasMol ]
    AK6  [ RasMol ]  +environment [ RasMol ]
    AK7  [ RasMol ]  +environment [ RasMol ]
    AK8  [ RasMol ]  +environment [ RasMol ]
    AK9  [ RasMol ]  +environment [ RasMol ]
    AL1  [ RasMol ]  +environment [ RasMol ]
    AL2  [ RasMol ]  +environment [ RasMol ]
    AL3  [ RasMol ]  +environment [ RasMol ]
    AL4  [ RasMol ]  +environment [ RasMol ]
    AL5  [ RasMol ]  +environment [ RasMol ]
    AL6  [ RasMol ]  +environment [ RasMol ]
    AL7  [ RasMol ]  +environment [ RasMol ]
    AL8  [ RasMol ]  +environment [ RasMol ]
    AL9  [ RasMol ]  +environment [ RasMol ]
    AM1  [ RasMol ]  +environment [ RasMol ]
    AM2  [ RasMol ]  +environment [ RasMol ]
    AM3  [ RasMol ]  +environment [ RasMol ]
    AM4  [ RasMol ]  +environment [ RasMol ]
    AM5  [ RasMol ]  +environment [ RasMol ]
    AM6  [ RasMol ]  +environment [ RasMol ]
    AM7  [ RasMol ]  +environment [ RasMol ]
    AM8  [ RasMol ]  +environment [ RasMol ]
    AM9  [ RasMol ]  +environment [ RasMol ]
    AN1  [ RasMol ]  +environment [ RasMol ]
    AN2  [ RasMol ]  +environment [ RasMol ]
    AN3  [ RasMol ]  +environment [ RasMol ]
    AN4  [ RasMol ]  +environment [ RasMol ]
    AN5  [ RasMol ]  +environment [ RasMol ]
    AN6  [ RasMol ]  +environment [ RasMol ]
    AN7  [ RasMol ]  +environment [ RasMol ]
    AN8  [ RasMol ]  +environment [ RasMol ]
    AN9  [ RasMol ]  +environment [ RasMol ]
    AO1  [ RasMol ]  +environment [ RasMol ]
    AO2  [ RasMol ]  +environment [ RasMol ]
    AO3  [ RasMol ]  +environment [ RasMol ]
    AO4  [ RasMol ]  +environment [ RasMol ]
    AO5  [ RasMol ]  +environment [ RasMol ]
    AO6  [ RasMol ]  +environment [ RasMol ]
    AO7  [ RasMol ]  +environment [ RasMol ]
    AO8  [ RasMol ]  +environment [ RasMol ]
    AO9  [ RasMol ]  +environment [ RasMol ]
    AP1  [ RasMol ]  +environment [ RasMol ]
    AP2  [ RasMol ]  +environment [ RasMol ]
    AP3  [ RasMol ]  +environment [ RasMol ]
    AP4  [ RasMol ]  +environment [ RasMol ]
    AP5  [ RasMol ]  +environment [ RasMol ]
    AP6  [ RasMol ]  +environment [ RasMol ]
    AP7  [ RasMol ]  +environment [ RasMol ]
    AP8  [ RasMol ]  +environment [ RasMol ]
    AP9  [ RasMol ]  +environment [ RasMol ]
    AQ1  [ RasMol ]  +environment [ RasMol ]
    AQ2  [ RasMol ]  +environment [ RasMol ]
    AQ3  [ RasMol ]  +environment [ RasMol ]
    AQ4  [ RasMol ]  +environment [ RasMol ]
    AQ5  [ RasMol ]  +environment [ RasMol ]
    AQ6  [ RasMol ]  +environment [ RasMol ]
    AQ7  [ RasMol ]  +environment [ RasMol ]
    AQ8  [ RasMol ]  +environment [ RasMol ]
    AQ9  [ RasMol ]  +environment [ RasMol ]
    AR1  [ RasMol ]  +environment [ RasMol ]
    AR2  [ RasMol ]  +environment [ RasMol ]
    AR3  [ RasMol ]  +environment [ RasMol ]
    AR4  [ RasMol ]  +environment [ RasMol ]
    AR5  [ RasMol ]  +environment [ RasMol ]
    AR6  [ RasMol ]  +environment [ RasMol ]
    AR7  [ RasMol ]  +environment [ RasMol ]
    AR8  [ RasMol ]  +environment [ RasMol ]
    AR9  [ RasMol ]  +environment [ RasMol ]
    AS1  [ RasMol ]  +environment [ RasMol ]
    AS2  [ RasMol ]  +environment [ RasMol ]
    AS3  [ RasMol ]  +environment [ RasMol ]
    AS4  [ RasMol ]  +environment [ RasMol ]
    AS5  [ RasMol ]  +environment [ RasMol ]
    AS6  [ RasMol ]  +environment [ RasMol ]
    AS7  [ RasMol ]  +environment [ RasMol ]
    AS8  [ RasMol ]  +environment [ RasMol ]
    AS9  [ RasMol ]  +environment [ RasMol ]
    AT1  [ RasMol ]  +environment [ RasMol ]
    AT2  [ RasMol ]  +environment [ RasMol ]
    AT3  [ RasMol ]  +environment [ RasMol ]
    AT4  [ RasMol ]  +environment [ RasMol ]
    AT5  [ RasMol ]  +environment [ RasMol ]
    AT6  [ RasMol ]  +environment [ RasMol ]
    AT7  [ RasMol ]  +environment [ RasMol ]
    AT8  [ RasMol ]  +environment [ RasMol ]
    AT9  [ RasMol ]  +environment [ RasMol ]
    AU1  [ RasMol ]  +environment [ RasMol ]
    AU2  [ RasMol ]  +environment [ RasMol ]
    AU3  [ RasMol ]  +environment [ RasMol ]
    AU4  [ RasMol ]  +environment [ RasMol ]
    AU5  [ RasMol ]  +environment [ RasMol ]
    AU6  [ RasMol ]  +environment [ RasMol ]
    AU7  [ RasMol ]  +environment [ RasMol ]
    AU8  [ RasMol ]  +environment [ RasMol ]
    AU9  [ RasMol ]  +environment [ RasMol ]
    AV1  [ RasMol ]  +environment [ RasMol ]
    AV2  [ RasMol ]  +environment [ RasMol ]
    AV3  [ RasMol ]  +environment [ RasMol ]
    AV4  [ RasMol ]  +environment [ RasMol ]
    AV5  [ RasMol ]  +environment [ RasMol ]
    AV6  [ RasMol ]  +environment [ RasMol ]
    AV7  [ RasMol ]  +environment [ RasMol ]
    AV8  [ RasMol ]  +environment [ RasMol ]
    AV9  [ RasMol ]  +environment [ RasMol ]
    AW1  [ RasMol ]  +environment [ RasMol ]
    AW2  [ RasMol ]  +environment [ RasMol ]
    AW3  [ RasMol ]  +environment [ RasMol ]
    AW4  [ RasMol ]  +environment [ RasMol ]
    AW5  [ RasMol ]  +environment [ RasMol ]
    AW6  [ RasMol ]  +environment [ RasMol ]
    AW7  [ RasMol ]  +environment [ RasMol ]
    AW8  [ RasMol ]  +environment [ RasMol ]
    AW9  [ RasMol ]  +environment [ RasMol ]
    AX1  [ RasMol ]  +environment [ RasMol ]
    AX2  [ RasMol ]  +environment [ RasMol ]
    AX3  [ RasMol ]  +environment [ RasMol ]
    AX4  [ RasMol ]  +environment [ RasMol ]
    AX5  [ RasMol ]  +environment [ RasMol ]
    AX6  [ RasMol ]  +environment [ RasMol ]
    AX7  [ RasMol ]  +environment [ RasMol ]
    AX8  [ RasMol ]  +environment [ RasMol ]
    AX9  [ RasMol ]  +environment [ RasMol ]
    AY1  [ RasMol ]  +environment [ RasMol ]
    AY2  [ RasMol ]  +environment [ RasMol ]
    AY3  [ RasMol ]  +environment [ RasMol ]
    AY4  [ RasMol ]  +environment [ RasMol ]
    AY5  [ RasMol ]  +environment [ RasMol ]
    AY6  [ RasMol ]  +environment [ RasMol ]
    AY7  [ RasMol ]  +environment [ RasMol ]
    AY8  [ RasMol ]  +environment [ RasMol ]
    AY9  [ RasMol ]  +environment [ RasMol ]
    AZ1  [ RasMol ]  +environment [ RasMol ]
    AZ2  [ RasMol ]  +environment [ RasMol ]
    AZ3  [ RasMol ]  +environment [ RasMol ]
    AZ4  [ RasMol ]  +environment [ RasMol ]
    AZ5  [ RasMol ]  +environment [ RasMol ]
    AZ6  [ RasMol ]  +environment [ RasMol ]
    AZ7  [ RasMol ]  +environment [ RasMol ]
    AZ8  [ RasMol ]  +environment [ RasMol ]
    AZ9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    BD1  [ RasMol ]  +environment [ RasMol ]
    BD2  [ RasMol ]  +environment [ RasMol ]
    BD3  [ RasMol ]  +environment [ RasMol ]
    BD4  [ RasMol ]  +environment [ RasMol ]
    BD5  [ RasMol ]  +environment [ RasMol ]
    BD6  [ RasMol ]  +environment [ RasMol ]
    BD7  [ RasMol ]  +environment [ RasMol ]
    BD8  [ RasMol ]  +environment [ RasMol ]
    BD9  [ RasMol ]  +environment [ RasMol ]
    BE1  [ RasMol ]  +environment [ RasMol ]
    BE2  [ RasMol ]  +environment [ RasMol ]
    BE3  [ RasMol ]  +environment [ RasMol ]
    BE4  [ RasMol ]  +environment [ RasMol ]
    BE5  [ RasMol ]  +environment [ RasMol ]
    BE6  [ RasMol ]  +environment [ RasMol ]
    BE7  [ RasMol ]  +environment [ RasMol ]
    BE8  [ RasMol ]  +environment [ RasMol ]
    BE9  [ RasMol ]  +environment [ RasMol ]
    BF1  [ RasMol ]  +environment [ RasMol ]
    BF2  [ RasMol ]  +environment [ RasMol ]
    BF3  [ RasMol ]  +environment [ RasMol ]
    BF4  [ RasMol ]  +environment [ RasMol ]
    BF5  [ RasMol ]  +environment [ RasMol ]
    BF6  [ RasMol ]  +environment [ RasMol ]
    BF7  [ RasMol ]  +environment [ RasMol ]
    BF8  [ RasMol ]  +environment [ RasMol ]
    BF9  [ RasMol ]  +environment [ RasMol ]
    BG1  [ RasMol ]  +environment [ RasMol ]
    BG2  [ RasMol ]  +environment [ RasMol ]
    BG3  [ RasMol ]  +environment [ RasMol ]
    BG4  [ RasMol ]  +environment [ RasMol ]
    BG5  [ RasMol ]  +environment [ RasMol ]
    BG6  [ RasMol ]  +environment [ RasMol ]
    BG7  [ RasMol ]  +environment [ RasMol ]
    BG8  [ RasMol ]  +environment [ RasMol ]
    BG9  [ RasMol ]  +environment [ RasMol ]
    BH1  [ RasMol ]  +environment [ RasMol ]
    BH2  [ RasMol ]  +environment [ RasMol ]
    BH3  [ RasMol ]  +environment [ RasMol ]
    BH4  [ RasMol ]  +environment [ RasMol ]
    BH5  [ RasMol ]  +environment [ RasMol ]
    BH6  [ RasMol ]  +environment [ RasMol ]
    BH7  [ RasMol ]  +environment [ RasMol ]
    BH8  [ RasMol ]  +environment [ RasMol ]
    BH9  [ RasMol ]  +environment [ RasMol ]
    BI1  [ RasMol ]  +environment [ RasMol ]
    BI2  [ RasMol ]  +environment [ RasMol ]
    BI3  [ RasMol ]  +environment [ RasMol ]
    BI4  [ RasMol ]  +environment [ RasMol ]
    BI5  [ RasMol ]  +environment [ RasMol ]
    BI6  [ RasMol ]  +environment [ RasMol ]
    BI7  [ RasMol ]  +environment [ RasMol ]
    BI8  [ RasMol ]  +environment [ RasMol ]
    BI9  [ RasMol ]  +environment [ RasMol ]
    BJ1  [ RasMol ]  +environment [ RasMol ]
    BJ2  [ RasMol ]  +environment [ RasMol ]
    BJ3  [ RasMol ]  +environment [ RasMol ]
    BJ4  [ RasMol ]  +environment [ RasMol ]
    BJ5  [ RasMol ]  +environment [ RasMol ]
    BJ6  [ RasMol ]  +environment [ RasMol ]
    BJ7  [ RasMol ]  +environment [ RasMol ]
    BJ8  [ RasMol ]  +environment [ RasMol ]
    BJ9  [ RasMol ]  +environment [ RasMol ]
    BK1  [ RasMol ]  +environment [ RasMol ]
    BK2  [ RasMol ]  +environment [ RasMol ]
    BK3  [ RasMol ]  +environment [ RasMol ]
    BK4  [ RasMol ]  +environment [ RasMol ]
    BK5  [ RasMol ]  +environment [ RasMol ]
    BK6  [ RasMol ]  +environment [ RasMol ]
    BK7  [ RasMol ]  +environment [ RasMol ]
    BK8  [ RasMol ]  +environment [ RasMol ]
    BK9  [ RasMol ]  +environment [ RasMol ]
    BL1  [ RasMol ]  +environment [ RasMol ]
    BL2  [ RasMol ]  +environment [ RasMol ]
    BL3  [ RasMol ]  +environment [ RasMol ]
    BL4  [ RasMol ]  +environment [ RasMol ]
    BL5  [ RasMol ]  +environment [ RasMol ]
    BL6  [ RasMol ]  +environment [ RasMol ]
    BL7  [ RasMol ]  +environment [ RasMol ]
    BL8  [ RasMol ]  +environment [ RasMol ]
    BL9  [ RasMol ]  +environment [ RasMol ]
    BM1  [ RasMol ]  +environment [ RasMol ]
    BM2  [ RasMol ]  +environment [ RasMol ]
    BM3  [ RasMol ]  +environment [ RasMol ]
    BM4  [ RasMol ]  +environment [ RasMol ]
    BM5  [ RasMol ]  +environment [ RasMol ]
    BM6  [ RasMol ]  +environment [ RasMol ]
    BM7  [ RasMol ]  +environment [ RasMol ]
    BM8  [ RasMol ]  +environment [ RasMol ]
    BM9  [ RasMol ]  +environment [ RasMol ]
    BN1  [ RasMol ]  +environment [ RasMol ]
    BN2  [ RasMol ]  +environment [ RasMol ]
    BN3  [ RasMol ]  +environment [ RasMol ]
    BN4  [ RasMol ]  +environment [ RasMol ]
    BN5  [ RasMol ]  +environment [ RasMol ]
    BN6  [ RasMol ]  +environment [ RasMol ]
    BN7  [ RasMol ]  +environment [ RasMol ]
    BN8  [ RasMol ]  +environment [ RasMol ]
    BN9  [ RasMol ]  +environment [ RasMol ]
    BO1  [ RasMol ]  +environment [ RasMol ]
    BO2  [ RasMol ]  +environment [ RasMol ]
    BO3  [ RasMol ]  +environment [ RasMol ]
    BO4  [ RasMol ]  +environment [ RasMol ]
    BO5  [ RasMol ]  +environment [ RasMol ]
    BO6  [ RasMol ]  +environment [ RasMol ]
    BO7  [ RasMol ]  +environment [ RasMol ]
    BO8  [ RasMol ]  +environment [ RasMol ]
    BO9  [ RasMol ]  +environment [ RasMol ]
    BP1  [ RasMol ]  +environment [ RasMol ]
    BP2  [ RasMol ]  +environment [ RasMol ]
    BP3  [ RasMol ]  +environment [ RasMol ]
    BP4  [ RasMol ]  +environment [ RasMol ]
    BP5  [ RasMol ]  +environment [ RasMol ]
    BP6  [ RasMol ]  +environment [ RasMol ]
    BP7  [ RasMol ]  +environment [ RasMol ]
    BP8  [ RasMol ]  +environment [ RasMol ]
    BP9  [ RasMol ]  +environment [ RasMol ]
    BQ1  [ RasMol ]  +environment [ RasMol ]
    BQ2  [ RasMol ]  +environment [ RasMol ]
    BQ3  [ RasMol ]  +environment [ RasMol ]
    BQ4  [ RasMol ]  +environment [ RasMol ]
    BQ5  [ RasMol ]  +environment [ RasMol ]
    BQ6  [ RasMol ]  +environment [ RasMol ]
    BQ7  [ RasMol ]  +environment [ RasMol ]
    BQ8  [ RasMol ]  +environment [ RasMol ]
    BQ9  [ RasMol ]  +environment [ RasMol ]
    BR1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp O:118 - Gly O:119   [ RasMol ]  
    Asp O:192 - Gly O:193   [ RasMol ]  
    Asp S:214 - Pro S:215   [ RasMol ]  
    Asp o:118 - Gly o:119   [ RasMol ]  
    Asp o:192 - Gly o:193   [ RasMol ]  
    Asp s:214 - Pro s:215   [ RasMol ]  
    Gly S:142 - Pro S:143   [ RasMol ]  
    Gly s:142 - Pro s:143   [ RasMol ]  
    Ile S:167 - Pro S:168   [ RasMol ]  
    Ile s:167 - Pro s:168   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mdx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CB1C_ARATH | P04778
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CB4A_ARATH | Q07473
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CB5_ARATH | Q9XF89
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBA_ARATH | P83755
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBB_ARATH | P56777
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBC_ARATH | P56778
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBD_ARATH | P56761
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBE_ARATH | P56779
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBF_ARATH | P62095
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBH_ARATH | P56780
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBI_ARATH | P62100
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBK_ARATH | P56782
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBL_ARATH | P60129
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBM_ARATH | P62109
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBO1_ARATH | P23321
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBT_ARATH | P61839
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBW_ARATH | Q39194
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PSBZ_ARATH | P56790
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q9LMQ2_ARATH | Q9LMQ2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q9SKI3_ARATH | Q9SKI3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.10.3.9
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CB1C_ARATH | P04778
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CB4A_ARATH | Q07473
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CB5_ARATH | Q9XF89
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBA_ARATH | P83755
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBB_ARATH | P56777
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBC_ARATH | P56778
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBD_ARATH | P56761
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBE_ARATH | P56779
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBF_ARATH | P62095
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBH_ARATH | P56780
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBI_ARATH | P62100
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBK_ARATH | P56782
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBL_ARATH | P60129
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBM_ARATH | P62109
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBO1_ARATH | P23321
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBT_ARATH | P61839
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBW_ARATH | Q39194
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PSBZ_ARATH | P56790
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9LMQ2_ARATH | Q9LMQ2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9SKI3_ARATH | Q9SKI3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5MDX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MDX)