Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  MYRISTOYLATED T41I/T78I MUTANT OF M-PMV MATRIX PROTEIN
 
Authors :  T. Kroupa, R. Hrabal
Date :  27 Jun 16  (Deposition) - 27 Jul 16  (Release) - 30 Nov 16  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
NMR Structure *:  A  (1x)
Keywords :  Matrix Protein, M-Pmv, Retrovirus, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Kroupa, H. Langerova, M. Dolezal, J. Prchal, V. Spiwok, E. Hunter, M. Rumlova, R. Hrabal, T. Ruml
Membrane Interactions Of The Mason-Pfizer Monkey Virus Matrix Protein And Its Budding Deficient Mutants.
J. Mol. Biol. V. 428 4708 2016
PubMed-ID: 27725181  |  Reference-DOI: 10.1016/J.JMB.2016.10.010

(-) Compounds

Molecule 1 - MYRISTOYLATED M-PMV MATRIX PROTEIN MUTANT
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System Taxid469008
    GeneGAG
    MutationYES
    Organism CommonMPMV
    Organism ScientificMASON-PFIZER MONKEY VIRUS
    Organism Taxid11855
    SynonymCORE POLYPROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (30x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1MYR1Ligand/IonMYRISTIC ACID
NMR Structure * (1, 1)
No.NameCountTypeFull Name
1MYR1Ligand/IonMYRISTIC ACID

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:2 , HIS A:8 , LYS A:33 , ILE A:51 , LYS A:93 , GLN A:98binding site for residue MYR A 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5LDL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5LDL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LDL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LDL)

(-) Exons   (0, 0)

(no "Exon" information available for 5LDL)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ldl A   2 GQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDICPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVIAFSYWNLIKELIDKKEVNPQVMAAVAQTEEILKSNSQTDLEHHHHHH 125
                                    11        21        31        41        51        61        71        81        91       101       111       121    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LDL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LDL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LDL)

(-) Gene Ontology  (14, 14)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MYR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ldl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ldl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GAG_MPMV | P07567
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GAG_MPMV | P07567
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GAG_MPMV | P075671bax 1cl4 2kgf 2lpy 2mv4 4ard 5lmy

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5LDL)