Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PLEXIN A1 EXTRACELLULAR FRAGMENT, DOMAINS 7-10 (IPT3-IPT6)
 
Authors :  Y. Kong, B. J. C. Janssen, T. Malinauskas, V. R. Vangoor, C. H. Coles, R. K T. Ni, R. J. C. Gilbert, S. Padilla-Parra, R. J. Pasterkamp, E. Y. Jones
Date :  03 Jun 16  (Deposition) - 15 Mar 17  (Release) - 15 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Ipt Domain, Signaling Protein, Receptor, Axon Guidance (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Kong, B. J. Janssen, T. Malinauskas, V. R. Vangoor, C. H. Coles, R. Kaufmann, T. Ni, R. J. Gilbert, S. Padilla-Parra, R. J. Pasterkamp, E. Y. Jones
Structural Basis For Plexin Activation And Regulation.
Neuron V. 91 548 2016
PubMed-ID: 27397516  |  Reference-DOI: 10.1016/J.NEURON.2016.06.018

(-) Compounds

Molecule 1 - PLEXIN-A1
    Chains: A
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Cell Line: HEK293 S
    Expression System Common: HUMAN
    Expression System Taxid: 9606
    Gene: PLXNA1, KIAA4053
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: PLEXIN-1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1EDO1Ligand/Ion1,2-ETHANEDIOL
2NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
3PEG1Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:1049 , GLU A:1054 , SER A:1140binding site for residue EDO A 1304
2AC2SOFTWAREGLY A:901 , LYS A:902 , LEU A:928 , SER A:1113 , PRO A:1114 , PRO A:1115binding site for residue PEG A 1305
3AC3SOFTWAREARG A:968 , SER A:1021 , ASN A:1041binding site for Mono-Saccharide NAG A 1303 bound to ASN A 1041
4AC4SOFTWAREASN A:1096 , THR A:1098 , THR A:1099 , PRO A:1194 , NAG A:1302binding site for Mono-Saccharide NAG A 1301 bound to ASN A 1096
5AC5SOFTWAREASN A:1096 , ASN A:1185 , NAG A:1301 , HOH A:1444binding site for Mono-Saccharide NAG A 1302 bound to ASN A 1185

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:905 -A:920
2A:999 -A:1011
3A:1092 -A:1102
4A:1195 -A:1206

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Ser A:868 -Pro A:869
2Ser A:965 -Pro A:966
3Asp A:1052 -Pro A:1053

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5L7N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5L7N)

(-) Exons   (0, 0)

(no "Exon" information available for 5L7N)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:344
                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..eee.....eeeeeeeee..hhhhh...eee..eeeee.hhhh..eeeeeeee.........ee.eeee.....eee....eeee..eeeeee..eee.....eeeeeee........eeee..eeeeeeee...eeeee.......eeeeeeeee..eeeeeeeeeeeee...eeeeee..eee.....eeeeeeehhhhh...eeeeee..eeeeeeeeeee..eeeee...................eeeee...hhhhh.......eee...ee....eeeeee..............ee..............eeee....eee..eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5l7n A  861 DPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVHVGKVLCSPVESEYISAEQIVCEIGDASTLRAHDALVEVCVRLHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSIGGRPCSFSWRNSREIRCLTPPGHTPGSAPIVININRAQLSNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENSCMVYNDTTMVCRAPSIDNPKRSPPELGERPDEIGFIMDNVRTLLVLNSSSFLYYPDPVLEPSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCILTVSETQLLCEAPTVRAGGFEFS 1227
                                   870       880       890       900       910       920       930       940|      953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143      1165      1175      1185      1195      1205   || 1223    
                                                                                                         940|                                                                                                                                                                                                            1152|                                        1209|         
                                                                                                          944                                                                                                                                                                                                             1165                                         1218
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5L7N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5L7N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5L7N)

(-) Gene Ontology  (19, 19)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:1052 - Pro A:1053   [ RasMol ]  
    Ser A:868 - Pro A:869   [ RasMol ]  
    Ser A:965 - Pro A:966   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5l7n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLXA1_MOUSE | P70206
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PLXA1_MOUSE | P70206
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLXA1_MOUSE | P70206: 3ryt 5l56 5l59 5l5c

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5L7N)