5K0W - JenaLib

Title :   CRYSTAL STRUCTURE OF THE METALLO-BETA-LACTAMASE GOB-18 FROM ELIZABETHKINGIA MENINGOSEPTICA

Authors :   A. Buschiazzo, N. Larrieux, A. J. Vila, M. N. Lisa, J. Moran-Barrio

Date :   17 May 16 (Deposition) - 03 Aug 16 (Release) - 05 Oct 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.61

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Metallo-Beta-Lactamase, B3 Lactamase, Zinc Hydrolase, Hydrolysis Of Beta-Lactam Antibiotics, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Moran-Barrio, M. N. Lisa, N. Larrieux, S. I. Drusin, A. M. Viale, D. M. Moreno, A. Buschiazzo, A. J. Vila
Crystal Structure Of The Metallo-Beta-Lactamase Gob In The Periplasmic Dizinc Form Reveals An Unusual Metal Site.
Antimicrob. Agents Chemother. V. 60 6013 2016
PubMed-ID: 27458232 | Reference-DOI: 10.1128/AAC.01067-16

Compounds

Molecule 1 - CLASS B CARBAPENEMASE GOB-18
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	C41 (DE3)
	Expression System Taxid	:	562
	Organism Scientific	:	ELIZABETHKINGIA MENINGOSEPTICA
	Organism Taxid	:	238

Structural Features

Chains, Units

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (3, 13)

Asymmetric Unit (3, 13)

No.	Name	Count	Type	Full Name
1	CL	8	Ligand/Ion	CHLORIDE ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	ZN	4	Ligand/Ion	ZINC ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	GOL	-1	Ligand/Ion	GLYCEROL
3	ZN	-1	Ligand/Ion	ZINC ION

Sites (10, 10)

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLN A:98 , ASP A:102 , HIS A:103 , HIS A:241 , ZN A:302 , HOH A:429	binding site for residue ZN A 301
02	AC2	SOFTWARE	GLN A:98 , HIS A:100 , HIS A:175 , ZN A:301 , HOH A:428 , HOH A:429	binding site for residue ZN A 302
03	AC3	SOFTWARE	LYS A:133 , SER B:134 , LYS B:177	binding site for residue CL A 303
04	AC4	SOFTWARE	VAL A:20 , LYS A:231	binding site for residue CL A 305
05	AC5	SOFTWARE	ASP A:206 , LYS A:207	binding site for residue CL A 306
06	AC6	SOFTWARE	ASP A:246 , HIS A:248	binding site for residue CL A 308
07	AC7	SOFTWARE	ALA A:34 , TYR A:35 , ASN A:80 , LYS A:83	binding site for residue GOL A 310
08	AC8	SOFTWARE	GLN B:98 , HIS B:100 , HIS B:175 , HOH B:425 , HOH B:426	binding site for residue ZN B 301
09	AC9	SOFTWARE	GLN B:98 , ASP B:102 , HIS B:103 , HIS B:241 , HOH B:426	binding site for residue ZN B 302
10	AD1	SOFTWARE	ASP B:246 , LEU B:247 , HIS B:248	binding site for residue CL B 303

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:270
                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhh.....eeee..eee........eeeee..eeeee.....hhhhhhhhhhhhh..hhh.eeeee....hhhhhhhhhhhhhhhh.eeeee..hhhhhhh......hhhhhh.........eee....eeee..eeeeeee........eeeeeeee....eeeeeee..................hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5k0w A  17 SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD 286
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286

Chain B from PDB  Type:PROTEIN  Length:271
                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhh.....eeee..eee........eeeee..eeeee.....hhhhhhhhhhhhh..hhh.eeeee....hhhhhhhhhhhhhhhh.eeeee..hhhhhhh......hhhhhh.........eee....eeee..eeeeeee........eeeeeeee....eeeeeee..................hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k0w B  20 VVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKDSQDK 290
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5k0w)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5k0w
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q4JRB6_ELIME \| Q4JRB6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q4JRB6_ELIME \| Q4JRB6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description