Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ASPARTATE AMINOTRANSFERASE (ASPAT) FROM CORYNEBACTERIUM GLUTAMICUM ATCC 13032
 
Authors :  H. F. Son, K. J. Kim
Date :  22 Mar 16  (Deposition) - 20 Jul 16  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Aminotransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. F. Son, K. J. Kim
Structural Insights Into A Novel Class Of Aspartate Aminotransferase From Corynebacterium Glutamicum.
Plos One V. 11 58402 2016
PubMed-ID: 27355211  |  Reference-DOI: 10.1371/JOURNAL.PONE.0158402

(-) Compounds

Molecule 1 - ASPARTATE AMINOTRANSFERASE
    Chains: A, B
    EC Number: 2.6.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET30A
    Expression System Strain: BL21(DE3)-T1R
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: CORE DOMAIN
    Gene: ASPB, CG0294
    Organism Scientific: CORYNEBACTERIUM GLUTAMICUM (STRAIN ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
    Organism Taxid: 196627
    Strain: ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 13)

Asymmetric/Biological Unit (3, 13)
No.NameCountTypeFull Name
1FLC1Ligand/IonCITRATE ANION
2GOL10Ligand/IonGLYCEROL
3PLP2Ligand/IonPYRIDOXAL-5'-PHOSPHATE

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:103 , SER A:104 , LEU A:105 , TYR A:142 , VAL A:186 , ASN A:191 , ASP A:220 , ALA A:222 , TYR A:223 , SER A:256 , SER A:258 , LYS A:259 , HOH A:714 , TYR B:73binding site for residue PLP A 501
02AC2SOFTWARETRP A:219 , ASN A:221 , ILE A:236 , ILE A:238 , ALA A:253 , PHE A:254 , THR A:255 , HOH A:668 , HOH A:677binding site for residue GOL A 502
03AC3SOFTWAREGLU A:95 , GLN A:96 , VAL A:239 , GLU A:243 , ARG A:277 , HOH A:655 , HOH A:724 , HOH A:829binding site for residue GOL A 503
04AC4SOFTWAREARG A:13 , PHE A:17 , ASP A:20 , VAL A:345binding site for residue GOL A 504
05AC5SOFTWAREARG A:83 , GLU A:95 , VAL A:97 , LEU A:98 , ARG A:277 , HOH A:686 , HOH A:765binding site for residue GOL A 505
06AC6SOFTWARELYS A:34 , LEU A:35 , ASP A:36 , GLY A:372 , HOH A:607binding site for residue GOL A 506
07AC7SOFTWARETYR A:73 , SER B:103 , SER B:104 , LEU B:105 , TYR B:142 , VAL B:186 , ASN B:191 , ASP B:220 , ALA B:222 , TYR B:223 , SER B:256 , SER B:258 , LYS B:259 , FLC B:502 , HOH B:625 , HOH B:655binding site for residue PLP B 501
08AC8SOFTWARETYR A:73 , ILE A:289 , ARG B:39 , GLY B:40 , TYR B:142 , ARG B:144 , TYR B:223 , LYS B:259 , ARG B:394 , PLP B:501binding site for residue FLC B 502
09AC9SOFTWAREGLU B:130 , GLU B:131 , THR B:132 , VAL B:133 , PHE B:152 , GLY B:153 , HOH B:601binding site for residue GOL B 503
10AD1SOFTWAREGLU B:45 , ALA B:318 , HOH B:641 , HOH B:785binding site for residue GOL B 504
11AD2SOFTWAREASP B:122 , VAL B:124 , PRO B:213 , HOH B:856 , HOH B:865binding site for residue GOL B 505
12AD3SOFTWAREPHE B:189 , GLY B:194 , PHE B:195 , THR B:196 , PRO B:346 , ALA B:347 , HOH B:622 , HOH B:673 , HOH B:917binding site for residue GOL B 506
13AD4SOFTWAREASP B:20 , THR B:229 , ALA B:321 , PHE B:324 , LEU B:328 , PRO B:346 , HOH B:682 , HOH B:713 , HOH B:894binding site for residue GOL B 507

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5IWQ)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Leu A:56 -Pro A:57
2Val A:139 -Pro A:140
3Asn A:191 -Pro A:192
4Leu B:56 -Pro B:57
5Val B:139 -Pro B:140
6Asn B:191 -Pro B:192

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IWQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IWQ)

(-) Exons   (0, 0)

(no "Exon" information available for 5IWQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:424
                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......hhhhhhhhhhhhhh......................hhhhhhhhhhhhh.hhh.eee...hhhhhhhhhhhhhhhhh......hhhhh...eeeeee..hhhhhhhhhhh..eeeeeeee..eehhhhhhhhh....eeeeee............hhhhhhhhhhh.......eeeee................hhhhhhhhh.....eeeeee...........eeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee........eeee....hhhhhhhhhhhh.ee.......hhhhh.....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5iwq A   4 VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANL 427
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423    


Chain B from PDB  Type:PROTEIN  Length:424
                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......hhhhhhhhhhhhhh......................hhhhhhhhhhhhh.hhh.eee...hhhhhhhhhhhhhhhh.......hhhhh...eeeeee..hhhhhhhhhhh..eeeeeeee..eehhhhhhhhh....eeeeee............hhhhhhhhhhh.......eeeee................hhhhhhhhh.....eeeeee...........eeeeehhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee........eeee....hhhhhhhhhhhh.ee.......hhhhh.....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5iwq B   4 VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANL 427
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IWQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IWQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IWQ)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:191 - Pro A:192   [ RasMol ]  
    Asn B:191 - Pro B:192   [ RasMol ]  
    Leu A:56 - Pro A:57   [ RasMol ]  
    Leu B:56 - Pro B:57   [ RasMol ]  
    Val A:139 - Pro A:140   [ RasMol ]  
    Val B:139 - Pro B:140   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5iwq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8NTR2_CORGL | Q8NTR2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8NTR2_CORGL | Q8NTR2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8NTR2_CORGL | Q8NTR2: 3ppl 5hxx

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5IWQ)