Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  IN-HOUSE SULFUR-SAD STRUCTURE OF ORTHORHOMBIC RED ABALONE LYSIN AT 1.66 A RESOLUTION
 
Authors :  H. Sadat Al-Hosseini, I. Raj, K. Nishimura, L. Jovine
Date :  01 Mar 16  (Deposition) - 14 Jun 17  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.66
Chains :  Asym./Biol. Unit :  A
Keywords :  Cell Adhesion, Fertilization, Egg-Sperm Interaction, Gamete Recognition, Egg-Binding Protein, Acrosomal Protein, Egg Coat Penetration, Crystal Dehydration, Sulfur-Sad, S-Sad (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I. Raj, H. Sadat Al Hosseini, E. Dioguardi, K. Nishimura, L. Han, A. Villa, D. De Sanctis, L. Jovine
Structural Basis Of Egg Coat-Sperm Recognition At Fertilization.
Cell V. 169 1315 2017
PubMed-ID: 28622512  |  Reference-DOI: 10.1016/J.CELL.2017.05.033
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EGG-LYSIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PJEXPRESS411
    Expression System Taxid: 469008
    Expression System Variant: PRARE STAR
    Expression System Vector Type: PLASMID
    Organism Common: CALIFORNIA RED ABALONE
    Organism Scientific: HALIOTIS RUFESCENS
    Organism Taxid: 6454
    Synonym: SPERM-LYSIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric/Biological Unit (2, 10)
No.NameCountTypeFull Name
1MES1Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
2SO49Ligand/IonSULFATE ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELYS A:51 , ARG A:54 , HOH A:312 , HOH A:314 , HOH A:338binding site for residue SO4 A 201
02AC2SOFTWARELYS A:27 , ASN A:30 , LYS A:31 , HIS A:79 , ASN A:82 , HOH A:310 , HOH A:391 , HOH A:400 , HOH A:404 , HOH A:436binding site for residue SO4 A 202
03AC3SOFTWARELYS A:65 , TYR A:118 , HOH A:327 , HOH A:442binding site for residue SO4 A 203
04AC4SOFTWAREPHE A:28 , VAL A:149 , LYS A:150 , TYR A:151 , MET A:152 , HOH A:361 , HOH A:430binding site for residue SO4 A 204
05AC5SOFTWARETRP A:86 , LYS A:90 , ARG A:113 , HOH A:305 , HOH A:308 , HOH A:348binding site for residue SO4 A 205
06AC6SOFTWAREARG A:47 , LYS A:51 , HOH A:363binding site for residue SO4 A 206
07AC7SOFTWAREARG A:47 , ARG A:54 , LYS A:131 , HOH A:322binding site for residue SO4 A 207
08AC8SOFTWAREVAL A:99 , GLY A:101 , ARG A:105 , HOH A:301 , HOH A:307binding site for residue SO4 A 208
09AC9SOFTWARETHR A:59 , LYS A:124 , ARG A:141 , HOH A:432binding site for residue SO4 A 209
10AD1SOFTWAREASN A:82 , TYR A:83 , TRP A:86 , ARG A:113 , ILE A:114 , HOH A:310 , HOH A:328 , HOH A:368 , HOH A:404binding site for residue MES A 210

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5II7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5II7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5II7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5II7)

(-) Exons   (0, 0)

(no "Exon" information available for 5II7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:132
                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.hhhhhhhhhhh......hhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ii7 A  21 WHYVEPKFLNKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINKKIDALGRTPVVGDYTRLGAEIGRRIDMAYFYDFLKDKNMIPKYLPYMEEINRMRPADVPVKYM 152
                                    30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5II7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5II7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5II7)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ii7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ii7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ELYS_HALRU | P04552
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ELYS_HALRU | P04552
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ELYS_HALRU | P04552: 1lis 1lyn 2lis 2lyn 5ii8 5ii9 5iia 5iib 5mr3

(-) Related Entries Specified in the PDB File

1lis 1lyn 2lis 2lyn 5ii8 5ii9 5iia