5IF6 - JenaLib

Title :   STRUCTURE OF A COMPUTATIONALLY DESIGNED 17-OHP BINDER

Authors :   B. L. Stoddard, L. A. Doyle

Date :   25 Feb 16 (Deposition) - 01 Mar 17 (Release) - 01 Mar 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: E  (1x)
Biol. Unit 6: F  (1x)

Keywords :   Rossetta, Ligand Binder, Computational, Structural Genomics, De Novo Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. L. Stoddard
Tbd
To Be Published
PubMed: search

Compounds

Molecule 1 - OHP9_1C
	Chains	:	A, B, C, D, E, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	SYNTHETIC CONSTRUCT
	Organism Taxid	:	32630

Structural Features

Chains, Units

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:					E
Biological Unit 6 (1x)	:						F

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (2, 9)

Asymmetric Unit (2, 9)

No.	Name	Count	Type	Full Name
1	3QZ	6	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	3	Ligand/Ion	SODIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	3QZ	1	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	3QZ	1	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	3QZ	1	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	3QZ	1	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 5 (1, 1)

No.	Name	Count	Type	Full Name
1	3QZ	1	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 6 (1, 1)

No.	Name	Count	Type	Full Name
1	3QZ	1	Ligand/Ion	(9BETA)-17-HYDROXYPREGN-4-ENE-3,20-DIONE
2	NA	-1	Ligand/Ion	SODIUM ION

Sites (8, 8)

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:12 , THR A:16 , PHE A:107 , TYR A:124 , HOH A:301 , HOH A:302 , PHE F:99	binding site for residue 3QZ A 201
2	AC2	SOFTWARE	SER A:9	binding site for residue NA A 202
3	AC3	SOFTWARE	LEU B:12 , THR B:16 , ALA B:91 , PHE B:107 , TYR B:124 , HOH B:301 , HOH B:303 , PHE E:99	binding site for residue 3QZ B 201
4	AC4	SOFTWARE	SER B:9	binding site for residue NA B 202
5	AC5	SOFTWARE	LEU C:12 , GLY C:13 , THR C:16 , ALA C:91 , PHE C:107 , TYR C:124 , PHE D:99	binding site for residue 3QZ C 201
6	AC6	SOFTWARE	PHE C:99 , THR D:16 , TRP D:24 , THR D:43 , VAL D:103 , PHE D:107 , TYR D:124	binding site for residue 3QZ D 201
7	AC7	SOFTWARE	PHE B:99 , GLY E:13 , THR E:16 , THR E:43 , ALA E:91 , PHE E:107 , TYR E:124	binding site for residue 3QZ E 201
8	AC8	SOFTWARE	LEU F:12 , THR F:16 , THR F:43 , VAL F:71 , PHE F:107 , TYR F:124 , HOH F:301	binding site for residue 3QZ F 201

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Asymmetric Unit

No.	Residues
1	Thr A:36	-	Pro A:37
2	Thr B:36	-	Pro B:37
3	Thr C:36	-	Pro C:37
4	Thr D:36	-	Pro D:37
5	Thr E:36	-	Pro E:37
6	Thr F:36	-	Pro F:37

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh..hhhhhhhheeeeeeee..............eehhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeeeeee...eeeeeeeeeeeee.....eeeeeee.hhhhheee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5if6 A   1 TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain B from PDB  Type:PROTEIN  Length:133
                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh.hhhhhhh.eeeeeeee..............eehhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee.....eeeeeee.hhhhheee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5if6 B   2 QSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ 134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131

Chain C from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh..hhhhhhhheeeeeeee..............eehhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee.....eeeeeee.hhhhheee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5if6 C   1 TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain D from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh..hhhhhhhheeeeeeee..............eehhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeeeeee...eeeeeeeeeeeee.....eeeeeee.hhhhheee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5if6 D   1 TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain E from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh..hhhhhhhheeeeeeee..............eehhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeeeee.....eeeeeeeeeeee.....eeeeeee.hhhhheee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5if6 E   1 TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEFDGGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ 134
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain F from PDB  Type:PROTEIN  Length:131
                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh..hhhhhhhheeeeeeee..............eehhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeeee...eeeeeeeeeeee.....eeeeeee.hhhhheee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5if6 F   1 TQSPALIASQSLGRCTQAKDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFWDTHIADDRVTVTCEETFPSSSPDEIAHILVAHAEGFTSEVRGVFTYRVNKAGLITNLRGYYNLDMMTFGNQ 134
                                    10        20        30        40        50        60        70        80        90   ||  103       113       123       133 
                                                                                                                        94|                                    
                                                                                                                         98

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		3QZ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Thr A:36 - Pro A:37	[ RasMol ]
		Thr B:36 - Pro B:37	[ RasMol ]
		Thr C:36 - Pro C:37	[ RasMol ]
		Thr D:36 - Pro D:37	[ RasMol ]
		Thr E:36 - Pro E:37	[ RasMol ]
		Thr F:36 - Pro F:37	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5if6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

Description