Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MH-K1 CHITOSANASE IN SUBSTRATE-BOUND FORM
 
Authors :  M. Suzuki, A. Saito, A. Ando, K. Miki, J. Saito
Date :  29 Jan 16  (Deposition) - 08 Feb 17  (Release) - 08 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym./Biol. Unit :  A
Keywords :  Chitosanase, Gh-46, Hydrolase, Substrate-Bound Form (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Suzuki, A. Saito, M. Kobayashi, T. Yokoyama, S. Omiya, J. Li, K. Sugita, A. Ando, K. Miki, J. Saito
Understanding For The Catalytic Mechanism Based On The Substrate-Bound Structure Of Gh-46 Chitosanase From Bacillu Circulans Mh-K1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CHITOSANASE
    Chains: A
    EC Number: 3.2.1.132
    Engineered: YES
    Expression System: BREVIBACILLUS CHOSHINENSIS
    Expression System Taxid: 54911
    Gene: CSN
    Mutation: YES
    Organism Scientific: BACILLUS CIRCULANS
    Organism Taxid: 1397
    Strain: MH-K1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 15)

Asymmetric/Biological Unit (4, 15)
No.NameCountTypeFull Name
1ACY3Ligand/IonACETIC ACID
2CAC1Ligand/IonCACODYLATE ION
3GCS4Ligand/IonD-GLUCOSAMINE
4ZN7Ligand/IonZINC ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:97 , MET A:109 , ASP A:255 , TRP A:256 , GLU A:257 , ACY A:306 , ACY A:307 , ACY A:308 , ZN A:309 , ZN A:310 , HOH A:429 , HOH A:575 , HOH A:617binding site for residue CAC A 305
02AC2SOFTWAREPRO A:79 , SER A:95 , ALA A:96 , GLU A:257 , CAC A:305 , ACY A:307 , ZN A:309 , HOH A:544 , HOH A:575binding site for residue ACY A 306
03AC3SOFTWAREGLU A:257 , CAC A:305 , ACY A:306 , ZN A:309 , HOH A:414 , HOH A:443 , HOH A:617binding site for residue ACY A 307
04AC4SOFTWAREASP A:97 , LYS A:108 , MET A:109 , ASP A:255 , CAC A:305 , ZN A:310 , HOH A:670 , HOH A:725binding site for residue ACY A 308
05AC5SOFTWAREGLU A:257 , CAC A:305 , ACY A:306 , ACY A:307binding site for residue ZN A 309
06AC6SOFTWAREASP A:97 , ASP A:255 , CAC A:305 , ACY A:308binding site for residue ZN A 310
07AC7SOFTWAREASP A:52 , GLU A:54 , HOH A:691 , HOH A:751binding site for residue ZN A 311
08AC8SOFTWAREHOH A:440 , HOH A:455 , HOH A:628 , HOH A:695 , HOH A:774binding site for residue ZN A 312
09AC9SOFTWAREHOH A:484 , HOH A:572 , HOH A:630binding site for residue ZN A 313
10AD1SOFTWAREGCS A:304 , HOH A:654binding site for residue ZN A 314
11AD2SOFTWARELYS A:204 , LYS A:230 , ASP A:233 , ASP A:237 , HOH A:606 , HOH A:721binding site for residue ZN A 315
12AD3SOFTWAREGLN A:37 , ASP A:55 , ARG A:57 , PHE A:64 , GLY A:65 , THR A:67 , ASP A:73 , HIS A:75 , ASP A:77 , TYR A:148 , LEU A:175 , ASN A:176 , GLN A:177 , GLY A:178 , ALA A:179 , THR A:180 , GLY A:181 , LYS A:218 , TYR A:219 , ZN A:314 , HOH A:409 , HOH A:435 , HOH A:444 , HOH A:446 , HOH A:465 , HOH A:480 , HOH A:481 , HOH A:499 , HOH A:536 , HOH A:604 , HOH A:619 , HOH A:635 , HOH A:654 , HOH A:697 , HOH A:719binding site for Poly-Saccharide residues GCS A 301 through GCS A 304

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:50 -A:124

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Pro A:222 -Pro A:223

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HWA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HWA)

(-) Exons   (0, 0)

(no "Exon" information available for 5HWA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:259
                                                                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhh..ee........ee....ee.........hhhhhhhhhhhhh.....hhhhhhhhh...eeee..eeee..hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhhhhhh....hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh......hhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hwa A   1 ASPDDNFSPETLQFLRNNTGLDGEQWNNIMKLINKPQQDDLNWIKYYGYCEDIEDERGYTIGLFGATTGGSRDTHPDGPDLFKAYDAAKGASNPSADGALKRLGINGKMKGSILEIKDSEKVFCGKIKKLQNDAAWRKAMWETFYNVYIRYSVEQARQRGFTSAVTIGSFVDTALNQGATGGSDTLQGLLARSGSSSNEKTFMKNFHAKRTLVVDTNKYNKPPNGKNRVKQWDTLVDMGKMNLKNVDSEIAQVTDWEMK 259
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HWA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HWA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HWA)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CAC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GCS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:222 - Pro A:223   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hwa
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CHIS_BACCI | P33673
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.132
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CHIS_BACCI | P33673
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CHIS_BACCI | P33673: 1qgi 2d05

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HWA)