Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF T-TYPE PHYCOBILIPROTEIN LYASE CPET FROM PROCHLOROCOCCUS PHAGE P-HM1
 
Authors :  R. Gasper, J. Schwach, N. Frankenberg-Dinkel, E. Hofmann
Date :  11 Jan 16  (Deposition) - 18 Jan 17  (Release) - 22 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Beta Barrel, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Gasper, J. Schwach, J. Hartmann, A. Holtkamp, J. Wiethaus, N. Riedel, E. Hofmann, N. Frankenberg-Dinkel
Distinct Features Of Cyanophage-Encoded T-Type Phycobiliprotein Lyase Phi Cpet: The Role Of Auxiliary Metabolic Genes.
J. Biol. Chem. V. 292 3089 2017
PubMed-ID: 28073912  |  Reference-DOI: 10.1074/JBC.M116.769703

(-) Compounds

Molecule 1 - ANTENNA PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PASK-IBA45PLUS
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: CPET, PHM1_028
    Organism Scientific: PROCHLOROCOCCUS PHAGE P-HM1
    Organism Taxid: 445700
    Synonym: CPET

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2MG2Ligand/IonMAGNESIUM ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:301 , HOH A:303 , HOH A:327 , HOH B:311 , HOH B:320 , HOH B:339binding site for residue MG A 201
2AC2SOFTWAREGLU A:56 , GLN A:57 , HOH A:307 , HOH A:321 , GLU B:56 , GLN B:57binding site for residue ACT A 202
3AC3SOFTWAREHOH A:311 , HOH A:313 , HOH A:338 , HOH B:302 , HOH B:305 , HOH B:326binding site for residue MG B 201

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:65 -B:65
2A:76 -A:95
3B:76 -B:95

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Asn A:-1 -Ser A:0
2Cys A:65 -Pro A:66
3Asn B:-1 -Ser B:0
4Cys B:65 -Pro B:66

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HI8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HI8)

(-) Exons   (0, 0)

(no "Exon" information available for 5HI8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:136
                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhheeeehhhhhhhh......eeeeeeeee..eeeeeeee.......eeeeeeeeee...eeeee.....eeeee....eeeee..........eeeeeee...eeeeeeee........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hi8 A  -1 NSMIDKFCDWFEGEFDNWTQAASNPTKWAHIIVKHEKISEYKYHTSSRYSYMDKPYREQTVDIEYVCPELIIVHNPACDIIFKWTGIYFEGESEPDCQWNGQPLDSKARLYADEYHTWDVGYWEGSEGFFHFKKNV 134
                                     8        18        28        38        48        58        68        78        88        98       108       118       128      


Chain B from PDB  Type:PROTEIN  Length:136
                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhheeeehhhhhhhh......eeeeeeeee..eeeeeeee.......eeeeeeeeee...eeeee.....eeeee....eeeee..........eeeeeee...eeeeeeee........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hi8 B  -1 NSMIDKFCDWFEGEFDNWTQAASNPTKWAHIIVKHEKISEYKYHTSSRYSYMDKPYREQTVDIEYVCPELIIVHNPACDIIFKWTGIYFEGESEPDCQWNGQPLDSKARLYADEYHTWDVGYWEGSEGFFHFKKNV 134
                                     8        18        28        38        48        58        68        78        88        98       108       118       128
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HI8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HI8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HI8)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:-1 - Ser A:0   [ RasMol ]  
    Asn B:-1 - Ser B:0   [ RasMol ]  
    Cys A:65 - Pro A:66   [ RasMol ]  
    Cys B:65 - Pro B:66   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hi8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  E3SMK9_9CAUD | E3SMK9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  E3SMK9_9CAUD | E3SMK9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5HI8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HI8)