Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN GCN5 BOUND TO PROPIONYL-COA
 
Authors :  C. Wolberger, A. E. Ringel
Date :  23 Dec 15  (Deposition) - 23 Mar 16  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Gcn5, Coenzyme A, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. E. Ringel, C. Wolberger
Structural Basis For Acyl-Group Discrimination By Human Gcn5L2.
Acta Crystallogr D Struct V. 72 841 2016 Biol
PubMed-ID: 27377381  |  Reference-DOI: 10.1107/S2059798316007907

(-) Compounds

Molecule 1 - HISTONE ACETYLTRANSFERASE KAT2A
    ChainsA
    EC Number2.3.1.48
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneKAT2A, GCN5, GCN5L2, HGCN5
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGENERAL CONTROL OF AMINO ACID SYNTHESIS PROTEIN 5-LIKE 2, HISTONE ACETYLTRANSFERASE GCN5,HSGCN5,LYSINE ACETYLTRANSFERASE 2A, STAF97

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
11VU1Ligand/IonPROPIONYL COENZYME A
2EDO3Ligand/Ion1,2-ETHANEDIOL
3IPA1Ligand/IonISOPROPYL ALCOHOL

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:8 , ALA A:18 , ASN A:19 , ARG A:21 , TRP A:25 , GLN A:36 , LEU A:37 , VAL A:83 , CYS A:85 , ALA A:86 , VAL A:87 , GLN A:92 , VAL A:93 , LYS A:94 , GLY A:95 , GLY A:97 , THR A:98 , THR A:118 , TYR A:119 , TYR A:123 , ALA A:124 , GLY A:126 , TYR A:127 , PHE A:128 , LYS A:130 , HOH A:313 , HOH A:316 , HOH A:338 , HOH A:348 , HOH A:364 , HOH A:373binding site for residue 1VU A 201
2AC2SOFTWAREGLY A:3 , ASP A:51 , LYS A:53 , ARG A:72 , LYS A:149binding site for residue EDO A 202
3AC3SOFTWARETHR A:88 , SER A:89 , ASN A:90 , LEU A:114 , TYR A:115binding site for residue EDO A 203
4AC4SOFTWARETHR A:98 , ASN A:102 , LYS A:105 , LYS A:130 , GLN A:131binding site for residue EDO A 204
5AC5SOFTWARELYS A:17 , GLN A:77 , TYR A:115 , VAL A:139 , PRO A:140 , ARG A:143 , HOH A:310binding site for residue IPA A 205

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5H84)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5H84)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5H84)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5H84)

(-) Exons   (0, 0)

(no "Exon" information available for 5H84)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:164
                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.......hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh....eeeeeee..eeeeeeeeeee....eeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhh.ee.....hhhhhh.........eeeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h84 A   2 SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRI 165
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5H84)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5H84)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5H84)

(-) Gene Ontology  (57, 57)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1VU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5h84)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5h84
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAT2A_HUMAN | Q92830
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.48
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAT2A_HUMAN | Q92830
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAT2A_HUMAN | Q928301f68 1z4r 3d7c 5h86

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5H84)