Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE C-TERMINAL LON PROTEASE-LIKE DOMAIN OF THERMUS THERMOPHILUS RADA/SMS
 
Authors :  M. Inoue, K. Fukui, Y. Fujii, N. Nakagawa, T. Yano, S. Kuramitsu, R. Masu
Date :  30 Oct 16  (Deposition) - 03 May 17  (Release) - 21 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (3x)
Keywords :  Ribosomal Protein S5 Domain 2-Like Fold, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Inoue, K. Fukui, Y. Fujii, N. Nakagawa, T. Yano, S. Kuramitsu, R. Masui
The Lon Protease-Like Domain In The Bacterial Reca Paralog Rada Is Required For Dna Binding And Repair.
J. Biol. Chem. V. 292 9801 2017
PubMed-ID: 28432121  |  Reference-DOI: 10.1074/JBC.M116.770180

(-) Compounds

Molecule 1 - DNA REPAIR PROTEIN RADA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-HISTEV
    Expression System Strain: ROSETTA 2(DE3)
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 262-423
    Gene: RADA, TTHA0541
    Organism Scientific: THERMUS THERMOPHILUS (STRAIN HB8 / ATCC 27634 / DSM 579)
    Organism Taxid: 300852
    Strain: HB8 / ATCC 27634 / DSM 579

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (3x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5H45)

(-) Sites  (0, 0)

(no "Site" information available for 5H45)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5H45)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5H45)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5H45)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5H45)

(-) Exons   (0, 0)

(no "Exon" information available for 5H45)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:152
                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee..eeeeeeeeeeeee.......eeee..hhhhhhhhhhhhhhh.......eeeeeee.......hhhhhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eee......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h45 A 272 GVPGSAVALALAGERALALEVQALAAKTPFPAPRRVVQGLDGRRVDVVLAVLERRLGLPLANLDVYVNLAGGLKVQDPGLDLAVALAVYSAVVGRPLPADLALVGEVGLAGEVRRVAGLERRLREGERAGFGRFLHPGNLKRLQEAVEAYLA 423
                                   281       291       301       311       321       331       341       351       361       371       381       391       401       411       421  


Chain B from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeee..eeeeeeeeeeeee.......eeee..hhhhhhhhhhhhhhhhh.....eeeeeee.......hhhhhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eee......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h45 B 267 KERPLGVPGSAVALALAGERALALEVQALAAKTPFPAPRRVVQGLDGRRVDVVLAVLERRLGLPLANLDVYVNLAGGLKVQDPGLDLAVALAVYSAVVGRPLPADLALVGEVGLAGEVRRVAGLERRLREGERAGFGRFLHPGNLKRLQEAVEAYLA 423
                                   276       286       296       306       316       326       336       346       356       366       376       386       396       406       416
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5H45)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5H45)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5H45)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5h45)
 
  Sites
(no "Sites" information available for 5h45)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5h45)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5h45
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SKV2_THET8 | Q5SKV2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5SKV2_THET8 | Q5SKV2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5H45)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5H45)