Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF NADH-CYTOCHROME B5 REDUCTASE REFINED WITH THE MULTIPOLAR ATOMIC MODEL AT 0.78A
 
Authors :  K. Takaba, K. Takeda, K. Miki
Date :  03 Sep 16  (Deposition) - 05 Apr 17  (Release) - 05 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  0.78
Chains :  Asym./Biol. Unit :  A
Keywords :  Oxidoreductase, Electron Transfer, Flavoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Takaba, K. Takeda, M. Kosugi, T. Tamada, K. Miki
Distribution Of Valence Electrons Of The Flavin Cofactor In Nadh-Cytochrome B5 Reductase.
Sci Rep V. 7 43162 2017
PubMed-ID: 28225078  |  Reference-DOI: 10.1038/SREP43162

(-) Compounds

Molecule 1 - NADH-CYTOCHROME B5 REDUCTASE 3
    Chains: A
    EC Number: 1.6.2.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: CYB5R3, DIA1
    Organism Common: PIG
    Organism Scientific: SUS SCROFA
    Organism Taxid: 9823
    Synonym: CYTOCHROME B5 REDUCTASE,DIAPHORASE-1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2GOL4Ligand/IonGLYCEROL

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:1063 , PRO A:1064 , TYR A:1065 , THR A:1066 , VAL A:1080 , ILE A:1081 , LYS A:1082 , TYR A:1084 , PHE A:1085 , THR A:1088 , HIS A:1089 , PHE A:1092 , GLY A:1095 , GLY A:1096 , LYS A:1097 , MET A:1098 , SER A:1099 , THR A:1153 , THR A:1156 , PRO A:1157 , GOL A:1304 , GOL A:1305 , HOH A:1405 , HOH A:1454 , HOH A:1494 , HOH A:1543 , HOH A:1545 , HOH A:1567 , HOH A:1579 , HOH A:1650 , HOH A:1709 , HOH A:1733binding site for residue FAD A 1301
2AC2SOFTWAREPRO A:1038 , GLY A:1075 , ASP A:1170 , HOH A:1421 , HOH A:1574 , HOH A:1745 , HOH A:1878binding site for residue GOL A 1302
3AC3SOFTWAREGLY A:1151 , GLY A:1152 , ALA A:1180 , ASN A:1181 , ASP A:1211 , PHE A:1223 , PRO A:1247 , MET A:1250 , HOH A:1408 , HOH A:1441 , HOH A:1569 , HOH A:1625 , HOH A:1708 , HOH A:1735binding site for residue GOL A 1303
4AC4SOFTWAREALA A:1094 , GLY A:1095 , LYS A:1097 , FAD A:1301 , HOH A:1418 , HOH A:1490 , HOH A:1546 , HOH A:1632 , HOH A:1898binding site for residue GOL A 1304
5AC5SOFTWARETHR A:1153 , GLY A:1154 , GLY A:1246 , PRO A:1247 , PRO A:1248 , FAD A:1301 , HOH A:1579 , HOH A:1668 , HOH A:1709 , HOH A:1726 , HOH A:1774binding site for residue GOL A 1305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GV8)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:1115 -Pro A:1116

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GV8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GV8)

(-) Exons   (0, 0)

(no "Exon" information available for 5GV8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:272
                                                                                                                                                                                                                                                                                                                 
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeeeeeeeee..eeeeeee..............eeeeeeee..eeeeeee..........eeeeeee.............hhhhhhhhhh....eeeeeeee..eeeee..eeee........eeee..eeeeeee..hhhhhhhhhhhhhh......eeeeeeee.hhhhh.hhhhhhhhhhhhh..eeeeeee.........ee...hhhhhhhhh.hhhhh.eeeee.hhhhhhhhhhhhhhhhh.hhhhhee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5gv8 A 1001 STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF 1272
                                  1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190      1200      1210      1220      1230      1240      1250      1260      1270
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GV8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GV8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GV8)

(-) Gene Ontology  (17, 17)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:1115 - Pro A:1116   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gv8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NB5R3_PIG | P83686
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.6.2.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NB5R3_PIG | P83686
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NB5R3_PIG | P83686: 1ndh 3w2e 3w2f 3w2g 3w2h 3w2i 3w5h 5gv7

(-) Related Entries Specified in the PDB File

5gv7