Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  LLAMA NANOBODY PORM_130
 
Authors :  P. Leone, A. Roussel
Date :  18 Feb 16  (Deposition) - 03 May 17  (Release) - 17 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Immune System, Type-9 Secretion System (T9Ss), Nanobody (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Duhoo, J. Roche, T. T. N. Trinh, A. Desmyter, A. Gaubert, C. Kellenberger, C. Cambillau, A. Roussel, P. Leone
Camelid Nanobodies Used As Crystallization Chaperones For Different Constructs Of Porm, A Component Of The Type Ix Secretion System From Porphyromonas Gingivalis.
Acta Crystallogr F Struct V. 73 286 2017 Biol Commun
PubMed-ID: 28471361  |  Reference-DOI: 10.1107/S2053230X17005969

(-) Compounds

Molecule 1 - NANOBODY
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPHEN6
    Expression System Taxid469008
    Expression System VariantROSETTA PLYSS
    Organism CommonLLAMA
    Organism ScientificLAMA GLAMA
    Organism Taxid9844

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5FWO)

(-) Sites  (0, 0)

(no "Site" information available for 5FWO)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:22 -A:92

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5FWO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5FWO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5FWO)

(-) Exons   (0, 0)

(no "Exon" information available for 5FWO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:129
                                                                                                                                                                  
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eeee....eeeeeeee..hhhhheeeeeee......eeeeee......eee..........eee....eeeeeee..hhhhheeeeeeee.hhhh..hhhhhhhhh.eeee...eeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                5fwo A    1 QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQAPGKEREFVTAISWSGGSIHYADSVKGRFTISRDNAKNTVYLLQMNSKPEDTAVYTCVAGFAGYGSFTSRSARDSDKYDYWGQGTKVTVS  112
                                    10        20        30        40        50  |     59        69        79 |  ||  86        96    ||100F|||||||103         
                                                                              52A                          80C  ||               100A|||||100J|||            
                                                                                                              82A|                100B|||||100K||            
                                                                                                               82B                 100C|||||100L|            
                                                                                                                                    100D|||||100M            
                                                                                                                                     100E||||                
                                                                                                                                      100F|||                
                                                                                                                                       100G||                
                                                                                                                                        100H|                
                                                                                                                                         100I                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5FWO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5FWO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5FWO)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5FWO)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5fwo)
 
  Sites
(no "Sites" information available for 5fwo)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5fwo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5fwo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5FWO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5FWO)