Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF OXIDIZED UDP-GALACTOPYRANOSE MUTASE FROM MYCOBACTERIUM SMEGMATIS IN COMPLEX WITH MAGNESIUM ION
 
Authors :  K. Wangkanont, L. L. Kiessling, K. T. Forest
Date :  03 Dec 15  (Deposition) - 07 Dec 16  (Release) - 07 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.04
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Wangkanont, L. L. Kiessling, K. T. Forest
Structural Dynamics Of Udp-Galactopyranose Mutase From Mycobacterium Smegmatis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UDP-GALACTOPYRANOSE MUTASE
    ChainsA
    EC Number5.4.99.9
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET24A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneGLF, MSMEG_6404, MSMEI_6236
    Organism ScientificMYCOBACTERIUM SMEGMATIS
    Organism Taxid246196
    StrainATCC 700084 / MC(2)155
    SynonymUDP-GALACTOPYRANOSE MUTASE GLF

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric Unit (3, 4)
No.NameCountTypeFull Name
1DMS2Ligand/IonDIMETHYL SULFOXIDE
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3MG1Ligand/IonMAGNESIUM ION
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
1DMS4Ligand/IonDIMETHYL SULFOXIDE
2FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:22 , GLY A:23 , GLY A:25 , PHE A:26 , PHE A:27 , ILE A:46 , GLU A:47 , ARG A:48 , ARG A:49 , GLY A:54 , ASN A:55 , TYR A:71 , ALA A:73 , HIS A:74 , LEU A:75 , THR A:232 , ASP A:233 , TRP A:234 , PHE A:235 , GLY A:254 , PRO A:255 , ARG A:258 , LEU A:272 , TYR A:336 , GLY A:368 , ARG A:369 , TYR A:375 , LEU A:376 , ASP A:377 , MET A:378 , ALA A:381 , HOH A:609 , HOH A:649 , HOH A:653 , HOH A:697 , HOH A:744 , HOH A:756binding site for residue FAD A 501
2AC2SOFTWAREASP A:330 , HOH A:618 , HOH A:727binding site for residue MG A 502
3AC3SOFTWARETRP A:175binding site for residue DMS A 503
4AC4SOFTWAREPHE A:284 , ARG A:323binding site for residue DMS A 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5F3R)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Phe A:111 -Pro A:112

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5F3R)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5F3R)

(-) Exons   (0, 0)

(no "Exon" information available for 5F3R)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:391
                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhhhhhh..eeee......hhhh.eee......eee......eee.hhhhhhhhh...........eeeee..eeeee..hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.................eee....hhhhhhhhhh....eeee...hhhhhhhhhhhhh....eee..hhhhhh........eeeeeeeeeee.........eeee........eeee.hhhh.........eeeeeeeeee........ee..hhhhhhhhhhhhhhhhhhhhhhheeehhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f3r A  15 GNFDLFVVGSGFFGLTIAERAATQLGKRVLVIERRPHIGGNAYSEPEPETGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFPMGLGLVSQFFGRYFSPDEARALIAEQASEIDTKDAKNFEEKAISLVGRPLYEAFIKHYTAKQWQTDPKDLPASNITRLPVRYTFDNRYFNDTYEGLPVEGYTKWLENMAADERIEVRLDTDWFDVRDDLRAANPDAPVVYTGPLDRYFDYAEGRLGWRTLDFELEVLETGDFQGTPVMNYNDLDVPYTRIHEFRHFHPERTYPTDKTVIMREYSRFADNDDEPYYPINTEADRAVLAAYRARAKAETASAKVLFGGRLGTYQYLDMHMAIASALSMFDNVLAPHLSEGASLVT 405
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5F3R)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5F3R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5F3R)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:111 - Pro A:112   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5f3r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0R629_MYCS2 | A0R629
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  5.4.99.9
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A0R629_MYCS2 | A0R629
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A0R629_MYCS2 | A0R6295eqd 5er9

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5F3R)