Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MYO3B-ARB2 IN COMPLEX WITH ESPIN1-AR
 
Authors :  H. Liu, J. Li, W. Liu, M. Zhang
Date :  17 Nov 15  (Deposition) - 03 Feb 16  (Release) - 03 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Unconventional Myosin, Protein Binding, Signaling, Protein Binding- Motor Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Liu, J. Li, M. H. Raval, N. Yao, X. Deng, Q. Lu, S. Nie, W. Feng, J. Wan, C. M. Yengo, W. Liu, M. Zhang
Myosin Iii-Mediated Cross-Linking And Stimulation Of Actin Bundling Activity Of Espin
Elife V. 5 2016
PubMed-ID: 26785147  |  Reference-DOI: 10.7554/ELIFE.12856

(-) Compounds

Molecule 1 - ESPIN
    Chains: A, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1-352
    Gene: ESPN
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: ECTOPLASMIC SPECIALIZATION PROTEIN
 
Molecule 2 - MYOSIN-IIIB
    Chains: B, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1252-1305
    Gene: MYO3B
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5ET0)

(-) Sites  (0, 0)

(no "Site" information available for 5ET0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5ET0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5ET0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5ET0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5ET0)

(-) Exons   (0, 0)

(no "Exon" information available for 5ET0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:327
                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhh.hhhhhhhhhhh.............hhhhhhhhh.hhhhhhhhhh..............hhhhhhhhh.hhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhh.hhhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh...........hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5et0 A    0 SMALEQALQAARRGDLDVLRSLHAAGLLDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTPLHDAAENGELECCQILAVNGAGLDVRDHDGYTAADLAEFNGHTHCSRYLRTVQTLS  331
                                     9        19       |34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       
                                                      27|                                                                                                                                                                                                                                                                                                          
                                                       33                                                                                                                                                                                                                                                                                                          


Chain B from PDB  Type:PROTEIN  Length:20
                                                     
               SCOP domains -------------------- SCOP domains
               CATH domains -------------------- CATH domains
               Pfam domains -------------------- Pfam domains
         Sec.struct. author ............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------- SAPs(SNPs)
                    PROSITE -------------------- PROSITE
                 Transcript -------------------- Transcript
                5et0 B 1288 GQIKVLDGEDQYYKCLSPGA 1307
                                  1297      1307


Chain C from PDB  Type:PROTEIN  Length:326
                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.hhhhhhhhh...........hhhhhhhhh.hhhhhhhhhh..............hhhhhhhhh.hhhhhhhhhh..............hhhhhhhhh.hhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh...........hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5et0 C    1 MALEQALQAARLDVLRSLHAAGLLSLRDSLDALPVHHAARSGKLHCLRYLVEEVALPAVSRARNGATPAHDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGALPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLEVTKYLVQECSADPHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHGAEISQDLWGGTPLHDAAENGELECCQILAVNGAGLDVRDHDGYTAADLAEFNGHTHCSRYLRTVQTLS  331
                                    10||      23   ||   35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325      
                                     11|          27|                                                                                                                                                                                                                                                                                                             
                                      15           30                                                                                                                                                                                                                                                                                                             


Chain D from PDB  Type:PROTEIN  Length:20
                                                     
               SCOP domains -------------------- SCOP domains
               CATH domains -------------------- CATH domains
               Pfam domains -------------------- Pfam domains
         Sec.struct. author ............hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------- SAPs(SNPs)
                    PROSITE -------------------- PROSITE
                 Transcript -------------------- Transcript
                5et0 D 1288 GQIKVLDGEDQYYKCLSPGA 1307
                                  1297      1307
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5ET0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5ET0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5ET0)

(-) Gene Ontology  (42, 48)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5et0)
 
  Sites
(no "Sites" information available for 5et0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5et0)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5et0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ESPN_MOUSE | Q9ET47
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MYO3B_MOUSE | Q1EG27
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ESPN_MOUSE | Q9ET47
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MYO3B_MOUSE | Q1EG27
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ESPN_MOUSE | Q9ET47: 5et1
        MYO3B_MOUSE | Q1EG27: 5et1

(-) Related Entries Specified in the PDB File

5et1