Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CYCLIZATION DOMAIN OF PHOMOPSIS AMYGDALI FUSICOCCADIENE SYNTHASE COMPLEXED WITH MAGNESIUM IONS AND PAMIDRONATE
 
Authors :  M. Chen, D. W. Christianson
Date :  14 Nov 15  (Deposition) - 20 Jan 16  (Release) - 27 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Diterpene Cyclase, Terpenoids, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Chen, W. K. Chou, T. Toyomasu, D. E. Cane, D. W. Christianson
Structure And Function Of Fusicoccadiene Synthase, A Hexameric Bifunctional Diterpene Synthase.
Acs Chem. Biol. V. 11 889 2016
PubMed-ID: 26734760  |  Reference-DOI: 10.1021/ACSCHEMBIO.5B00960

(-) Compounds

Molecule 1 - FUSICOCCADIENE SYNTHASE
    Chains: A, B
    EC Number: 4.2.3.43
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: FUSICOCCA-2,10(14)-DIENE SYNTHASE, RESIDUES 1-344
    Gene: PAFS
    Organism Scientific: PHOMOPSIS AMYGDALI
    Organism Taxid: 1214568

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 10)

Asymmetric Unit (3, 10)
No.NameCountTypeFull Name
12102Ligand/IonPAMIDRONATE
2CL2Ligand/IonCHLORIDE ION
3MG6Ligand/IonMAGNESIUM ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
12101Ligand/IonPAMIDRONATE
2CL-1Ligand/IonCHLORIDE ION
3MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
12101Ligand/IonPAMIDRONATE
2CL-1Ligand/IonCHLORIDE ION
3MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPHE A:89 , ASP A:92 , ASP A:96 , ARG A:188 , ASP A:191 , VAL A:192 , ASN A:232 , SER A:236 , LYS A:239 , GLU A:240 , ARG A:325 , TYR A:326 , MG A:403 , MG A:404 , MG A:405 , HOH A:501 , HOH A:505 , HOH A:508 , HOH A:513binding site for residue 210 A 401
02AC2SOFTWARETHR A:16 , GLU A:17 , HOH A:545 , GLN B:264 , THR B:265binding site for residue CL A 402
03AC3SOFTWAREASP A:92 , ASP A:96 , 210 A:401 , MG A:404 , HOH A:501 , HOH A:532 , HOH A:534binding site for residue MG A 403
04AC4SOFTWAREASP A:92 , ASP A:96 , LYS A:239 , GLU A:240 , 210 A:401 , MG A:403 , HOH A:505 , HOH A:508binding site for residue MG A 404
05AC5SOFTWAREARG A:188 , ASN A:232 , SER A:236 , GLU A:240 , 210 A:401 , HOH A:513binding site for residue MG A 405
06AC6SOFTWAREASP B:92 , ASP B:96 , MG B:702 , 210 B:704 , HOH B:801 , HOH B:821binding site for residue MG B 701
07AC7SOFTWAREASP B:92 , ASP B:96 , MG B:701 , 210 B:704 , HOH B:811 , HOH B:862 , HOH B:870binding site for residue MG B 702
08AC8SOFTWAREARG B:188 , ASN B:232 , SER B:236 , GLU B:240 , 210 B:704 , HOH B:832binding site for residue MG B 703
09AC9SOFTWAREASP B:92 , ARG B:188 , ASN B:232 , SER B:236 , LYS B:239 , GLU B:240 , ARG B:325 , TYR B:326 , MG B:701 , MG B:702 , MG B:703 , HOH B:801 , HOH B:832binding site for residue 210 B 704
10AD1SOFTWARETHR A:265 , TYR B:15 , THR B:16 , GLU B:17 , HOH B:824binding site for residue CL B 705

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5ERM)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1His B:100 -Asp B:101
2Ala B:134 -Gly B:135

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5ERM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5ERM)

(-) Exons   (0, 0)

(no "Exon" information available for 5ERM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:301
                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.................eee.hhhhhhhhhhhhhhhhhhhh..............hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5erm A   2 EFKYSEVVEPSTYYTEGLCEGIDVRKSKFTTLEDRGAIRAHEDWNKHIGPCREYRGTLGPRFSFISVAVPECIPERLEVISYANEFAFLHDDVTDGKKRIQSQLFLEMLAIDPECAKTTMKSWARFVEVGSSTRFVELAKYIPYRIMDVGEMFWFGLVTFGLGLHIPDHELELCRELMANAWIAVGLQNDIWSWPKERDAATLHGKDHVVNAIWVLMQEHQTDVDGAMQICRKLIVEYVAKYLEVIEATKNDESISLDLRKYLDAMLYSISGNVVWSLECPRYNPDVSFNKTQLEWMRQGL 344
                                    11        21        31        41        51        61        71        81        91    || 139       149       159       169 ||    183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343 
                                                                                                                         96|                                 171|                                                                                                                                                                        
                                                                                                                         135                                  176                                                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:314
                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.hhhhh...........eee..hhhhhhhhhhhhhhhhhhh..............hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5erm B   2 EFKYSEVVEPSTYYTEGLCEGIDVRKSKFTTLEDRGAIRAHEDWNKHIGPCREYRGTLGPRFSFISVAVPECIPERLEVISYANEFAFLHDDVTDHVGHDTDIRRAGKKRIQSQLFLEMLAIDPECAKTTMKSWARFVEVGSSRETRFVELAKYIPYRIMDVGEMFWFGLVTFGLGLHIPDHELELCRELMANAWIAVGLQNDIWSWPKERDAATLHGKDHVVNAIWVLMQEHQTDVDGAMQICRKLIVEYVAKYLEVIEATKNDESISLDLRKYLDAMLYSISGNVVWSLECPRYNPDVSFNKTQLEWMRQGL 344
                                    11        21        31        41        51        61        71        81        91       101||     138       148       158       168   ||  180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340    
                                                                                                                              102|                                       172|                                                                                                                                                                         
                                                                                                                               130                                        175
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5ERM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5ERM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5ERM)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    210  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala B:134 - Gly B:135   [ RasMol ]  
    His B:100 - Asp B:101   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5erm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FUSS_PHOAM | A2PZA5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.3.43
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FUSS_PHOAM | A2PZA5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FUSS_PHOAM | A2PZA5: 5er8 5ern 5ero

(-) Related Entries Specified in the PDB File

5er8 5ern 5ero