Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HEF-MUT WITH TR323 COMPLEX
 
Authors :  H. Song, J. Qi, Y. Shi, G. F. Gao
Date :  09 Oct 15  (Deposition) - 23 Mar 16  (Release) - 23 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (3x)
Biol. Unit 2:  C,D  (3x)
Keywords :  Influenza, Complex, Hef, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Song, J. Qi, Z. Khedri, S. Diaz, H. Yu, X. Chen, A. Varki, Y. Shi, G. F. Gao
An Open Receptor-Binding Cavity Of Hemagglutinin-Esterase-Fusion Glycoprotein From Newly-Identified Influenza D Virus: Basis For Its Broad Cel Tropism
Plos Pathog. V. 12 05505 2016
PubMed-ID: 26954772  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1005505

(-) Compounds

Molecule 1 - HEMAGGLUTININ-ESTERASE
    Chains: A, C
    Engineered: YES
    Expression System: TRICHOPLUSIA NI
    Expression System Cell Line: HI5
    Expression System Plasmid: PFASTBAC1
    Expression System Taxid: 7111
    Expression System Vector Type: BACULOVIRUS
    Fragment: UNP RESIDUES 19-445
    Gene: HEF
    Organism Scientific: INFLUENZA D VIRUS (D/SWINE/OKLAHOMA/1334/2011)
    Organism Taxid: 1173138
    Strain: D/SWINE/OKLAHOMA/1334/2011
 
Molecule 2 - HEMAGGLUTININ-ESTERASE
    Chains: B, D
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Taxid: 7108
    Fragment: UNP RESIDUES 464-612
    Gene: HEF
    Organism Scientific: INFLUENZA D VIRUS (D/SWINE/OKLAHOMA/1334/2011)
    Organism Taxid: 1173138
    Strain: D/SWINE/OKLAHOMA/1334/2011

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (3x): AB  
Biological Unit 2 (3x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 36)

Asymmetric Unit (6, 36)
No.NameCountTypeFull Name
15N62Ligand/Ion(2~{R},4~{S},5~{R},6~{R})-5-ACETAMIDO-6-[(1~{R},2~{R})-3-ACETYLOXY-1,2-BIS(OXIDANYL)PROPYL]-2,4-BIS(OXIDANYL)OXANE-2-CARBOXYLIC ACID
2BMA3Ligand/IonBETA-D-MANNOSE
3GAL2Ligand/IonBETA-D-GALACTOSE
4MAN9Ligand/IonALPHA-D-MANNOSE
5NAG18Ligand/IonN-ACETYL-D-GLUCOSAMINE
6Z3Q2Ligand/Ion2-AZIDOETHYL 2-(ACETYLAMINO)-2-DEOXY-BETA-D-GLUCOPYRANOSIDE
Biological Unit 1 (6, 60)
No.NameCountTypeFull Name
15N63Ligand/Ion(2~{R},4~{S},5~{R},6~{R})-5-ACETAMIDO-6-[(1~{R},2~{R})-3-ACETYLOXY-1,2-BIS(OXIDANYL)PROPYL]-2,4-BIS(OXIDANYL)OXANE-2-CARBOXYLIC ACID
2BMA6Ligand/IonBETA-D-MANNOSE
3GAL3Ligand/IonBETA-D-GALACTOSE
4MAN18Ligand/IonALPHA-D-MANNOSE
5NAG27Ligand/IonN-ACETYL-D-GLUCOSAMINE
6Z3Q3Ligand/Ion2-AZIDOETHYL 2-(ACETYLAMINO)-2-DEOXY-BETA-D-GLUCOPYRANOSIDE
Biological Unit 2 (6, 48)
No.NameCountTypeFull Name
15N63Ligand/Ion(2~{R},4~{S},5~{R},6~{R})-5-ACETAMIDO-6-[(1~{R},2~{R})-3-ACETYLOXY-1,2-BIS(OXIDANYL)PROPYL]-2,4-BIS(OXIDANYL)OXANE-2-CARBOXYLIC ACID
2BMA3Ligand/IonBETA-D-MANNOSE
3GAL3Ligand/IonBETA-D-GALACTOSE
4MAN9Ligand/IonALPHA-D-MANNOSE
5NAG27Ligand/IonN-ACETYL-D-GLUCOSAMINE
6Z3Q3Ligand/Ion2-AZIDOETHYL 2-(ACETYLAMINO)-2-DEOXY-BETA-D-GLUCOPYRANOSIDE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:12 , GLU A:13 , SER A:14 , MET A:28 , HOH A:984 , GLY B:19 , GLY B:20 , ALA B:22 , GLY B:23binding site for Poly-Saccharide residues NAG A 713 through NAG A 714 bound to ASN A 12
02AC2SOFTWAREASN A:130 , THR A:132 , GLN A:133 , LYS A:218 , ASN A:220 , ASN A:330 , GLU A:334 , LEU A:337 , GLN A:338 , LYS A:346 , NAG A:707 , NAG A:708 , MAN A:711 , HOH A:806 , HOH A:808 , HOH A:815 , HOH A:825 , HOH A:835 , HOH A:885 , HOH A:909 , HOH A:914 , HOH A:918 , HOH A:946 , HOH A:949 , HOH A:961 , HOH A:963 , HOH A:974binding site for Poly-Saccharide residues NAG A 701 through MAN A 706 bound to ASN A 130
03AC3SOFTWAREASN A:330 , GLU A:333 , GLU A:334 , LEU A:337 , NAG A:702 , BMA A:703 , MAN A:705 , HOH A:825 , HOH A:861 , HOH A:904 , HOH A:914 , HOH A:933 , HOH A:936 , HOH A:960 , ASN C:47 , GLN C:48 , LYS C:49binding site for Poly-Saccharide residues NAG A 707 through MAN A 712 bound to ASN A 330
04AC4SOFTWAREASN B:58 , ASN B:61 , GLU B:65 , HOH B:819 , HOH B:842binding site for Mono-Saccharide NAG B 703 bound to ASN B 58
05AC5SOFTWARESER A:19 , GLY A:20 , PHE A:21 , ASN A:24 , GLN A:424 , GLY A:426 , GLN B:55 , LEU B:56 , ASP B:59 , ASN B:107 , ASN B:111 , HOH B:801 , HOH B:805 , HOH B:845binding site for Poly-Saccharide residues NAG B 701 through NAG B 702 bound to ASN B 107
06AC6SOFTWAREASP A:64 , ASN C:12 , GLU C:13 , SER C:14 , MET C:28 , HOH C:822 , HOH C:919 , GLY D:19 , ALA D:22 , GLY D:23binding site for Poly-Saccharide residues NAG C 709 through NAG C 710 bound to ASN C 12
07AC7SOFTWAREASN C:130 , GLN C:133 , LYS C:218 , ASN C:220 , ASN C:330 , GLU C:334 , GLN C:338 , LYS C:346 , NAG C:707 , NAG C:708 , HOH C:804 , HOH C:808 , HOH C:811 , HOH C:816 , HOH C:828 , HOH C:839 , HOH C:853 , HOH C:881 , HOH C:905 , HOH C:931 , HOH C:938 , HOH C:944 , HOH C:996binding site for Poly-Saccharide residues NAG C 701 through MAN C 706 bound to ASN C 130
08AC8SOFTWARELYS A:49 , ASN C:330 , GLU C:333 , GLU C:334 , LEU C:337 , NAG C:702 , BMA C:703 , MAN C:704 , MAN C:705 , HOH C:807 , HOH C:811 , HOH C:927binding site for Poly-Saccharide residues NAG C 707 through NAG C 708 bound to ASN C 330
09AC9SOFTWAREASN D:58 , ASN D:61 , GLU D:65binding site for Mono-Saccharide NAG D 703 bound to ASN D 58
10AD1SOFTWARESER C:19 , GLY C:20 , ASN C:24 , GLN C:424 , GLY C:426 , GLN D:55 , LEU D:56 , ASP D:59 , SER D:102 , ASN D:107 , ASN D:111 , HOH D:803 , HOH D:817 , HOH D:829binding site for Poly-Saccharide residues NAG D 701 through NAG D 702 bound to ASN D 107
11AD2SOFTWAREPHE A:127 , GLY A:170 , THR A:171 , ALA A:172 , SER A:173 , TRP A:185 , TYR A:231 , PHE A:297 , HOH A:807binding site for Poly-Saccharide residues Z3Q A 715 through 5N6 A 717
12AD3SOFTWAREASN A:12 , GLU A:13 , SER A:14 , MET A:28 , PHE A:127 , GLY A:170 , THR A:171 , ALA A:172 , SER A:173 , TRP A:185 , TYR A:231 , PHE A:297 , NAG A:702 , NAG A:708 , BMA A:709 , MAN A:710 , NAG A:714 , Z3Q A:715 , HOH A:807 , HOH A:861 , HOH A:904 , HOH A:960 , GLY B:19 , GLY B:20 , ALA B:22 , GLY B:23 , GLN C:48 , LYS C:49 , PHE C:127 , GLY C:170 , THR C:171 , ALA C:172 , SER C:173 , TRP C:185 , PHE C:229 , TYR C:231 , PHE C:240 , VAL C:275 , PHE C:297 , HOH C:855 , HOH C:979binding site for Poly-Saccharide residues Z3Q C 711 through 5N6 C 713

(-) SS Bonds  (18, 18)

Asymmetric Unit
No.Residues
1A:6 -B:138
2A:106 -A:151
3A:126 -A:175
4A:200 -A:242
5A:219 -A:306
6A:227 -A:279
7A:336 -A:342
8A:378 -A:404
9B:146 -B:150
10C:6 -D:138
11C:106 -C:151
12C:126 -C:175
13C:200 -C:242
14C:219 -C:306
15C:227 -C:279
16C:336 -C:342
17C:378 -C:404
18D:146 -D:150

(-) Cis Peptide Bonds  (13, 13)

Asymmetric Unit
No.Residues
1Phe A:66 -Pro A:67
2Ser A:182 -Pro A:183
3Leu A:371 -Gly A:372
4Pro A:398 -Pro A:399
5Gly B:34 -Gly B:35
6Gly B:128 -Gly B:129
7Phe C:66 -Pro C:67
8Ser C:182 -Pro C:183
9Phe C:240 -Gly C:241
10Leu C:371 -Gly C:372
11Pro C:398 -Pro C:399
12Gly D:34 -Gly D:35
13Gly D:128 -Gly D:129

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5E62)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5E62)

(-) Exons   (0, 0)

(no "Exon" information available for 5E62)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:424
                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee....eee.....eeeeeeeee..................eeeee.hhhh............hhhhhh.eee....hhhhhhhh.........eee..eeeee.....hhhhh......hhhhhhhhhhhhhhhhhhh..eeeee...eeee.....ee..hhhhh.......eeee.............eeeeeee..ee..ee..eeeee..eee..hhhhhh.......eeeee.....eeeeee..............eee..eeee..eeeeeee...eeee...eeee.......eeee...........hhhhhhhhh...eeee.......eeee..eeehhhhhhhhhhhh....eee..eee.....ee.......eeee..ee.hhhhh.eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e62 A   3 ELICIVQRVNESFSLHSGFGGNVYSMKTEPMTGFTNVTKGASVINQKDWIGFGDARTDLTNDQFPASSDVPLAVAKKFRSLSGASLMLSAFGPPGKVDYLYQGCGKEKVFYEGVNWSPEAGIDCFGSNWTQTKKDFYSRIYEAARSSTCMTLVNSLDTKISSTTATAGTASSCSSSWMKSPLWYAESSVNPPQVCGTEQSATFTLPTSFGIYKCNKHVVQLCYFVYENKAKFNTFGCGDYYQNYYDGNGNLIGGMDNRVAAYRGIANAGVKIECPSKILNPGTYSIKSTPRFLLVPKRSYCFDTDGGYPIQVVQSEWSASRRSDNATEEACLQTEGCIFIKKTTPYVGEAADNAGDIEMRQLLSGLGNNDTVCVSQSGYTKGETPFVKDYLSPPKYGRCQLKTDSGRIPTLPSGLIIPQAGTDS 429
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192||     205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425    
                                                                                                                                                                                                                        193|                                                                                                                                                                                                                                        
                                                                                                                                                                                                                         197                                                                                                                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:149
                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee.......eeeeee.........ee.....hhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eee.......hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e62 B   9 FGLLFVGFVAGGVAGGYFWGRSNGGGGGASVSSTQAGFDKIGKDIQQLRNDTNAAIEGFNGRIAHDEQAIKNLAKEIEDARAEALVGELGIIRSLIVANISMNLKESLYELANQITKRGGGIAQEAGPGCWYVDSENCDASCKEYIFNF 157
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148         


Chain C from PDB  Type:PROTEIN  Length:424
                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee....eee.....eeeeeeeee..................eeeee.hhhh............hhhhhh.eee....hhhhhhhh.........eee..eeeee.....hhhhh......hhhhhhhhhhhhhhhhhhh..eeeee...eeee.....ee..hhhhh.......eeee.............eeeeeee..ee..ee..eeeee..eee..hhhhhh.......eeeee.....eeeeee..............eee..eeee..eeeeeee...eeee...eeee.......eeee...........hhhhhhhhh...eeee...............hhhhhhhhhhhhh..eeeee..eeee....ee.......eeee..ee.hhhhh.eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e62 C   3 ELICIVQRVNESFSLHSGFGGNVYSMKTEPMTGFTNVTKGASVINQKDWIGFGDARTDLTNDQFPASSDVPLAVAKKFRSLSGASLMLSAFGPPGKVDYLYQGCGKEKVFYEGVNWSPEAGIDCFGSNWTQTKKDFYSRIYEAARSSTCMTLVNSLDTKISSTTATAGTASSCSSSWMKSPLWYAESSVNPPQVCGTEQSATFTLPTSFGIYKCNKHVVQLCYFVYENKAKFNTFGCGDYYQNYYDGNGNLIGGMDNRVAAYRGIANAGVKIECPSKILNPGTYSIKSTPRFLLVPKRSYCFDTDGGYPIQVVQSEWSASRRSDNATEEACLQTEGCIFIKKTTPYVGEAADNAGDIEMRQLLSGLGNNDTVCVSQSGYTKGETPFVKDYLSPPKYGRCQLKTDSGRIPTLPSGLIIPQAGTDS 429
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192||     205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425    
                                                                                                                                                                                                                        193|                                                                                                                                                                                                                                        
                                                                                                                                                                                                                         197                                                                                                                                                                                                                                        


Chain D from PDB  Type:PROTEIN  Length:149
                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee.......eeeeee.........ee.....hhhhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eee.......hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e62 D   9 FGLLFVGFVAGGVAGGYFWGRSNGGGGGASVSSTQAGFDKIGKDIQQLRNDTNAAIEGFNGRIAHDEQAIKNLAKEIEDARAEALVGELGIIRSLIVANISMNLKESLYELANQITKRGGGIAQEAGPGCWYVDSENCDASCKEYIFNF 157
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5E62)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5E62)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5E62)

(-) Gene Ontology  (15, 15)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5N6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    Z3Q  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly B:128 - Gly B:129   [ RasMol ]  
    Gly B:34 - Gly B:35   [ RasMol ]  
    Gly D:128 - Gly D:129   [ RasMol ]  
    Gly D:34 - Gly D:35   [ RasMol ]  
    Leu A:371 - Gly A:372   [ RasMol ]  
    Leu C:371 - Gly C:372   [ RasMol ]  
    Phe A:66 - Pro A:67   [ RasMol ]  
    Phe C:240 - Gly C:241   [ RasMol ]  
    Phe C:66 - Pro C:67   [ RasMol ]  
    Pro A:398 - Pro A:399   [ RasMol ]  
    Pro C:398 - Pro C:399   [ RasMol ]  
    Ser A:182 - Pro A:183   [ RasMol ]  
    Ser C:182 - Pro C:183   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5e62
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  K9LG83_9ORTO | K9LG83
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  K9LG83_9ORTO | K9LG83
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        K9LG83_9ORTO | K9LG83: 5e5w 5e64 5e65 5e66

(-) Related Entries Specified in the PDB File

5e5w 5e64 5e65 5e66