5DYO - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   FAB43.1 COMPLEX WITH FLOURESCEIN

Authors :   K. L. Longenecker, R. A. Judge

Date :   25 Sep 15 (Deposition) - 27 Jan 16 (Release) - 10 Feb 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.36

Chains :   Asym. Unit : A,B,H,L
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: H,L  (1x)

Keywords :   Antibody Fab Flourescein, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Gayda, K. L. Longenecker, R. A. Judge, K. M. Swift, S. Manoj, D. S. Linthicum, S. Y. Tetin
Three-Dimensional Structure, Binding, And Spectroscopic Characteristics Of The Monoclonal Antibody 43. 1 Directed To The Carboxyphenyl Moiety Of Fluorescein.
Biopolymers V. 105 234 2016
PubMed-ID: 26756394 | Reference-DOI: 10.1002/BIP.22801

Molecule 1 - FAB 43.1 HEAVY CHAIN
	Chains	:	A, H
	Engineered	:	YES
	Expression System	:	MUS MUSCULUS
	Expression System Taxid	:	10090
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090

Molecule 2 - FAB 43.1 LIGHT CHAIN
	Chains	:	B, L
	Engineered	:	YES
	Expression System	:	MUS MUSCULUS
	Expression System Taxid	:	10090
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090

		1	2	3	4
Asymmetric Unit	:	A	B	H	L
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			H	L

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 7)

No.	Name	Count	Type	Full Name
1	FDS	2	Ligand/Ion	FLUORESCIN
2	SO4	5	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	FDS	1	Ligand/Ion	FLUORESCIN
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	FDS	1	Ligand/Ion	FLUORESCIN
2	SO4	3	Ligand/Ion	SULFATE ION

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:35 , ARG A:99 , HOH A:420 , TYR B:37 , ASN B:39 , ARG B:51 , TRP B:94 , GLY B:96 , GLN B:101 , SER L:32 , ASP L:33	binding site for residue FDS A 301
2	AC2	SOFTWARE	HIS B:98 , PHE B:99 , HIS L:98 , PHE L:99	binding site for residue SO4 B 901
3	AC3	SOFTWARE	GLU B:159 , ARG B:160 , GLN B:161 , ASN B:162	binding site for residue SO4 B 902
4	AC4	SOFTWARE	SER B:32 , ASP B:33 , HIS H:35 , ARG H:99 , HOH H:1029 , HOH H:1032 , TYR L:37 , ASN L:39 , ARG L:51 , TYR L:54 , TRP L:94 , GLY L:96 , GLN L:101	binding site for residue FDS H 901
5	AC5	SOFTWARE	GLY H:26 , LYS H:74 , ASN H:77 , HOH H:1002	binding site for residue SO4 H 902
6	AC6	SOFTWARE	ASN L:150 , LYS L:204 , THR L:205 , HOH L:429	binding site for residue SO4 L 301
7	AC7	SOFTWARE	GLU L:159 , ARG L:160 , GLN L:161 , ASN L:162	binding site for residue SO4 L 302

Asymmetric Unit

No.	Residues
1	A:22	-	A:96
2	A:140	-	A:195
3	B:23	-	B:93
4	B:139	-	B:199
5	H:22	-	H:96
6	H:140	-	H:195
7	L:23	-	L:93
8	L:139	-	L:199

Asymmetric Unit

No.	Residues
1	Phe A:146	-	Pro A:147
2	Glu A:148	-	Pro A:149
3	Gln A:171	-	Ser A:172
4	Asp A:173	-	Leu A:174
5	Trp A:188	-	Pro A:189
6	Thr B:7	-	Pro B:8
7	Phe B:99	-	Pro B:100
8	Tyr B:145	-	Pro B:146
9	Thr B:207	-	Ser B:208
10	Phe H:146	-	Pro H:147
11	Glu H:148	-	Pro H:149
12	Gln H:171	-	Ser H:172
13	Trp H:188	-	Pro H:189
14	Thr L:7	-	Pro L:8
15	Phe L:99	-	Pro L:100
16	Tyr L:145	-	Pro L:146

(no "SAP(SNP)/Variant" information available for 5DYO)

(no "PROSITE Motif" information available for 5DYO)

(no "Exon" information available for 5DYO)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...eee.....eeeeee...hhhhh..eeeeee......eeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeee........eeeee........eeeee....eeeeeeeeeee.....eeee.hhh....eee...ee....eeeeeeeeee.........eeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dyo A   2 VQLQQSGPELVKPGASVKMSCKASGYTFSTSVIHWVKQKPGQGLEWIGYIFPYNYGTQYNEEFRGKATLTSDKSSNTAYMELSSLTSEDSAVYYCASRSGPWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP 212
                                    11        21        31        41        51        61        71        81        91       101       111       121     ||137       147       157       167       177       187       197       207     
                                                                                                                                                       127|                                                                              
                                                                                                                                                        134

Chain B from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee....eeeeeee............eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee......ee...eeeeee......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..eee...eeeee.........eeeeeeeeeehhhhhh..eeeeeee.......eeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dyo B   1 DVVMTQTPLTLSITIGQPVSISCKSSQSLFASDGRTYLNWLLQRPGQSPERLIYLVSNLDSGVLDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE 218
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain H from PDB  Type:PROTEIN  Length:212
                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...eee.....eeeeee.hhhhhhhh.eeeeee......eeeeee......eee.hhhh..eeeeee....eeeeee...hhhhheeeeeee........eeeee........eeeee..hhhhh...eeeeeeeeeee.....eeee.hhh....eee...ee....eeeeeeeeee.........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dyo H   2 VQLQQSGPELVKPGASVKMSCKASGYTFSTSVIHWVKQKPGQGLEWIGYIFPYNYGTQYNEEFRGKATLTSDKSSNTAYMELSSLTSEDSAVYYCASRSGPWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR 213
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain L from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeee............eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee......ee...eeeee.......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..eee...eeeee.........eeeeeeeeeehhhhhhh.eeeeeee.......eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5dyo L   1 DVVMTQTPLTLSITIGQPVSISCKSSQSLFASDGRTYLNWLLQRPGQSPERLIYLVSNLDSGVLDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR 216
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 5DYO)

(no "CATH Domain" information available for 5DYO)

(no "Pfam Domain" information available for 5DYO)

Asymmetric Unit(hide GO term definitions)

(no "Gene Ontology" information available for 5DYO)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FDS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:173 - Leu A:174	[ RasMol ]
		Gln A:171 - Ser A:172	[ RasMol ]
		Gln H:171 - Ser H:172	[ RasMol ]
		Glu A:148 - Pro A:149	[ RasMol ]
		Glu H:148 - Pro H:149	[ RasMol ]
		Phe A:146 - Pro A:147	[ RasMol ]
		Phe B:99 - Pro B:100	[ RasMol ]
		Phe H:146 - Pro H:147	[ RasMol ]
		Phe L:99 - Pro L:100	[ RasMol ]
		Thr B:207 - Ser B:208	[ RasMol ]
		Thr B:7 - Pro B:8	[ RasMol ]
		Thr L:7 - Pro L:8	[ RasMol ]
		Trp A:188 - Pro A:189	[ RasMol ]
		Trp H:188 - Pro H:189	[ RasMol ]
		Tyr B:145 - Pro B:146	[ RasMol ]
		Tyr L:145 - Pro L:146	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	5dyo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

(no "Entries Sharing at Least One Protein Chain" available for 5DYO)

(no "Related Entries Specified in the PDB File" available for 5DYO)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 7)

Sites (7, 7)

SS Bonds (8, 8)

Cis Peptide Bonds (16, 16)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File