5DWM - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PHOSPHINOTHRICIN N-ACETYLTRANSFERASE FROM BRUCELLA OVIS

Authors :   Seattle Structural Genomics Center For Infectious Disease (S

Date :   22 Sep 15 (Deposition) - 02 Dec 15 (Release) - 02 Dec 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.45

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Ssgcid, Brucella Ovis, Brucellosis, Phosphinothricin N- Acetyltransferase, Acetylcoa, Iodide Phasing, Structural Genomics, Seattle Structural Genomics Center For Infectious Disease, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. C. Clifton, J. Abendroth, D. D. Lorimer, T. E. Edwards
Crystal Structure Of Phosphinothricin N-Acetyltransferase From Brucella Ovis
To Be Published
PubMed: search

Molecule 1 - PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
	Atcc	:	25840
	Chains	:	A, B, C, D
	EC Number	:	2.3.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	PAT, BOV_0087
	Organism Scientific	:	BRUCELLA OVIS (STRAIN ATCC 25840 / 63/290 / NCTC 10512)
	Organism Taxid	:	444178
	Strain	:	ATCC 25840 / 63/290 / NCTC 10512

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 9)

No.	Name	Count	Type	Full Name
1	EDO	4	Ligand/Ion	1,2-ETHANEDIOL
2	GOL	1	Ligand/Ion	GLYCEROL
3	IMD	4	Ligand/Ion	IMIDAZOLE

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
2	GOL	-1	Ligand/Ion	GLYCEROL
3	IMD	1	Ligand/Ion	IMIDAZOLE

Biological Unit 2 (3, 6)

No.	Name	Count	Type	Full Name
1	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
2	GOL	1	Ligand/Ion	GLYCEROL
3	IMD	3	Ligand/Ion	IMIDAZOLE

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:116 , GLN A:162 , PRO A:164 , HOH A:355 , HOH A:376	binding site for residue EDO A 200
2	AC2	SOFTWARE	GLN B:116 , GLN B:162 , PRO B:164 , HOH B:331 , HOH B:336	binding site for residue EDO B 200
3	AC3	SOFTWARE	ASP B:49 , GLN B:50 , GLY B:51 , LEU B:178	binding site for residue IMD B 201
4	AC4	SOFTWARE	GLN C:116 , GLN C:162 , PRO C:164 , HOH C:357 , HOH C:359	binding site for residue EDO C 200
5	AC5	SOFTWARE	ASP C:49 , GLN C:50 , GLY C:51	binding site for residue IMD C 201
6	AC6	SOFTWARE	ALA C:48 , ASP C:49	binding site for residue IMD C 202
7	AC7	SOFTWARE	GLN D:116 , GLN D:162 , PRO D:164 , HOH D:331 , HOH D:380	binding site for residue EDO D 200
8	AC8	SOFTWARE	ILE D:88 , GLY D:94 , GLY D:98 , LEU D:133 , HOH D:360 , HOH D:420 , HOH D:465	binding site for residue GOL D 201
9	AC9	SOFTWARE	ALA D:48 , ASP D:49 , HOH D:404	binding site for residue IMD D 202

(no "SS Bond" information available for 5DWM)

(no "Cis Peptide Bond" information available for 5DWM)

(no "SAP(SNP)/Variant" information available for 5DWM)

(no "PROSITE Motif" information available for 5DWM)

(no "Exon" information available for 5DWM)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:180
                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee.hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh..eeeeee..eeeeeeeeee...hhhhh.eeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5dwm A   0 HMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS 179
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179

Chain B from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh..eeeeee..eeeeeeeeee...hhhhh.eeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dwm B   1 MPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS 179
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain C from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh..eeeeee..eeeeeeeeee...hhhhh.eeeeeeee.......hhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dwm C   1 MPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS 179
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain D from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh..eeeeee..eeeeeeeeee...hhhhh.eeeeeeee.hhhh..hhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee............... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5dwm D   1 MPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS 179
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 5DWM)

(no "CATH Domain" information available for 5DWM)

(no "Pfam Domain" information available for 5DWM)

Asymmetric Unit(hide GO term definitions)

(no "Gene Ontology" information available for 5DWM)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		IMD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5dwm)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	5dwm
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	A0A0H3AQB6_B \| A0A0H3AQB6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	2.3.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	A0A0H3AQB6_B \| A0A0H3AQB6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	A0A0H3AQB6_B \| A0A0H3AQB6	:	5dwn

5dwn	ACETYLCOA-BOUND STRUCTURE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 9)

Sites (9, 9)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File