Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF WNK1 IN COMPLEX WITH WNK463
 
Authors :  D. Kohls, X. Xie
Date :  15 Sep 15  (Deposition) - 07 Sep 16  (Release) - 02 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym./Biol. Unit :  A
Keywords :  Kinase, Inhibitor, Complex, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Yamada, H. M. Park, D. F. Rigel, K. Dipetrillo, E. J. Whalen, A. Anisowicz, M. Beil, J. Berstler, C. E. Brocklehurst, D. A. Burdick, S. L. Caplan, M. P. Capparelli, G. Chen, W. Chen, B. Dale, L. Deng, F. Fu, N. Hamamatsu, K. Harasaki, T. Herr, P. Hoffmann, Q. Y. Hu, W. J. Huang, N. Idamakanti, H. Imase, Y. Iwaki, M. Jain, J. Jeyaseelan, M. Kato, V. K. Kaushik, D. Kohls, V. Kunjathoor, D. Lasala, J. Lee, J. Liu, Y. Luo F. Ma, R. Mo, S. Mowbray, M. Mogi, F. Ossola, P. Pandey, S. J. Patel, S. Raghavan, B. Salem, Y. H. Shanado, G. M. Trakshel, G. Turner, H. Wakai, C. Wang, S. Weldon, J. B. Wielicki, X. Xie, L. Xu, Y. I. Yagi, K. Yasoshima, J. Yin, D. Yowe, J. H. Zhang, G. Zheng, L. Monovich
Small-Molecule Wnk Inhibition Regulates Cardiovascular And Renal Function.
Nat. Chem. Biol. V. 12 896 2016
PubMed-ID: 27595330  |  Reference-DOI: 10.1038/NCHEMBIO.2168

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE WNK1
    Chains: A
    EC Number: 2.7.11.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 194-483
    Gene: WNK1, HSN2, PRKWNK1
    Mutation: YES
    Organism Common: RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Synonym: PROTEIN KINASE LYSINE-DEFICIENT 1, PROTEIN KINASE WITH NO LYSINE 1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
15FJ1Ligand/IonN-TERT-BUTYL-1-(1-{5-[5-(TRIFLUOROMETHYL)-1,3,4-OXADIAZOL-2-YL]PYRIDIN-2-YL}PIPERIDIN-4-YL)-1H-IMIDAZOLE-5-CARBOXAMIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:228 , VAL A:235 , ALA A:248 , CYS A:250 , PHE A:265 , ALA A:269 , LEU A:272 , PHE A:283 , LEU A:299 , THR A:301 , GLU A:302 , MET A:304 , PHE A:356 , ASP A:368 , LEU A:369 , GLY A:370 , HOH A:652 , HOH A:682 , HOH A:695binding site for residue 5FJ A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5DRB)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr A:342 -Pro A:343

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5DRB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5DRB)

(-) Exons   (0, 0)

(no "Exon" information available for 5DRB)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:273
                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.....eeeeeeeeee...eeeeeeee.....eeeeeee.....hhhhhhhhhhhhhhhhh........eeeeeeeee..eeeeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..............eee......eee...hhhhhh...............hhhhhhh...hhhhhhhhhhhhhhhhhh........hhhhhhhhhh....hhhhhhh.hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5drb A 209 TKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQE 481
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5DRB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5DRB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5DRB)

(-) Gene Ontology  (30, 30)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5FJ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:342 - Pro A:343   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5drb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  WNK1_RAT | Q9JIH7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  WNK1_RAT | Q9JIH7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        WNK1_RAT | Q9JIH7: 2lru 3fpq 4q2a

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5DRB)