Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CC1-FHA TANDEM OF KINESIN-3 KIF13A
 
Authors :  J. Q. Ren, W. Li, L. Huo, W. Feng
Date :  02 Sep 15  (Deposition) - 30 Dec 15  (Release) - 24 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.74
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transport Protein, Coiled-Coil, Fha Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Ren, L. Huo, W. Wang, Y. Zhang, W. Li, J. Lou, T. Xu, W. Feng
Structural Correlation Of The Neck Coil With The Coiled-Coi (Cc1)-Forkhead-Associated (Fha) Tandem For Active Kinesin-3 Kif13A
J. Biol. Chem. V. 291 3581 2016
PubMed-ID: 26680000  |  Reference-DOI: 10.1074/JBC.M115.689091

(-) Compounds

Molecule 1 - KINESIN-LIKE PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET32A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 386-555
    GeneKIF13A
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric/Biological Unit (3, 7)
No.NameCountTypeFull Name
1ACY1Ligand/IonACETIC ACID
2FMT5Ligand/IonFORMIC ACID
3PEG1Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:101 , TRP A:148 , GLY A:149 , ASN A:150 , ASN A:151 , HIS A:152 , HOH A:392binding site for residue FMT A 201
2AC2SOFTWAREGLY A:131 , THR A:132 , LEU A:133 , ARG A:155 , HOH A:371 , ARG B:145binding site for residue FMT A 202
3AC3SOFTWAREARG A:155 , HOH A:303 , HOH A:350 , LEU B:67 , ARG B:145binding site for residue FMT A 203
4AC4SOFTWARETRP A:25 , GLY B:99 , ILE B:100 , ASN B:151 , HIS B:152 , HOH B:331binding site for residue FMT B 201
5AC5SOFTWAREASP B:116 , ILE B:117 , GLN B:139 , LEU B:140 , TRP B:141 , LEU B:158binding site for residue ACY B 202
6AC6SOFTWARELEU A:73 , HOH A:302 , VAL B:57 , GLY B:58 , ASP B:59 , PRO B:159 , HOH B:358binding site for residue FMT B 203
7AC7SOFTWARETRP B:141 , HIS B:142 , LEU B:158 , HOH B:310 , HOH B:345binding site for residue PEG B 204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5DJO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5DJO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5DJO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5DJO)

(-) Exons   (0, 0)

(no "Exon" information available for 5DJO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:158
                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee..eeee.....eeee...........eee...eeeee......ee..........eeeee.....eeeee.....eee..ee....ee.....eeee...eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5djo A   2 MKAPELKEKLEESEKLIKELTVTWEEKLRKTEAIAQERQRQLESMGISLETSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVGADTSQDIQLFGIGIQPEHCEIDIAADGDITLTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFRINLP 159
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151        

Chain B from PDB  Type:PROTEIN  Length:160
                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee..eeee....eeeee...........eeee..eeeee......ee..........eeeee.....eeeee.....eee..ee....ee.....eeee...eeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5djo B   0 SAMKAPELKEKLEESEKLIKELTVTWEEKLRKTEAIAQERQRQLESMGISLETSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVGADTSQDIQLFGIGIQPEHCEIDIAADGDITLTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFRINLP 159
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5DJO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5DJO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5DJO)

(-) Gene Ontology  (31, 45)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5djo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5djo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F8VQ75_MOUSE | F8VQ75
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  KI13A_MOUSE | Q9EQW7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  F8VQ75_MOUSE | F8VQ75
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KI13A_MOUSE | Q9EQW7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        F8VQ75_MOUSE | F8VQ755djn

(-) Related Entries Specified in the PDB File

5djn