Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HCGB FROM METHANOCOCCUS MARIPALUDIS
 
Authors :  T. Fujishiro, U. Ermler, S. Shima
Date :  11 Aug 15  (Deposition) - 26 Oct 16  (Release) - 14 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Guanylyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Bai, T. Fujishiro, G. Huang, J. Koch, A. Takabayashi, M. Yokono, A. Tanaka, T. Xu, X. Hu, U. Ermler, S. Shima
Towards Artificial Methanogenesis: Biosynthesis Of The [Fe]-Hydrogenase Cofactor And Characterization Of The Semi-Synthetic Hydrogenase.
Faraday Discuss. V. 198 37 2017
PubMed-ID: 28294213  |  Reference-DOI: 10.1039/C6FD00209A

(-) Compounds

Molecule 1 - HCGB
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET24B
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneMMP1497
    Organism ScientificMETHANOCOCCUS MARIPALUDIS (STRAIN S2 / LL)
    Organism Taxid267377

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A C 
Biological Unit 2 (1x) B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5D5P)

(-) Sites  (0, 0)

(no "Site" information available for 5D5P)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D5P)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5D5P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D5P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D5P)

(-) Exons   (0, 0)

(no "Exon" information available for 5D5P)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhh.....eeee....hhhhhhh.hhhhhhhhhhhhhh...eeeeeee.......eeeeeee....eeeeeee........hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d5p A   2 NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVVK 158
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       

Chain B from PDB  Type:PROTEIN  Length:156
                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh......hhhhhhhhhhhhhh..eeee...hhhhhhhhhhhhh.....eeee....hhhhhhh.hhhhhhhhhhhhhh...eeeeeee.......eeeeeee....eeeeeee........hhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5d5p B   2 NIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVV 157
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151      

Chain C from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh..eeee...hhhhhhhhhhhhh.....eeee....hhhhhhh.hhhhhhhhhhhhhh...eeeeeee.......eeeeeee....eeeeeee........hhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d5p C   1 MNIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVV 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       

Chain D from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh......hhhhhhhhhhhhhh..eeee...hhhhhhhhhhhhh.....eeee....hhhhhhh.hhhhhhhhhhhhhh...eeeeeee.......eeeeeee....eeeeeee........hhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d5p D   1 MNIENTIKSAYEESLNNARFGDKIEEIDAIQSTIKSAKNVTVATSNEKKFKVVSDIISRITDANISMLEIPTNSADLTRMPALNKGLIAVDSSDADLIITRGRLGIPGSGSLLLIMDKKGRILTGSVSPSSIIHKNPIDKTVELELITALERIGIVV 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D5P)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D5P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D5P)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5D5P)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5d5p)
 
  Sites
(no "Sites" information available for 5d5p)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5d5p)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d5p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6LX55_METMP | Q6LX55
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6LX55_METMP | Q6LX55
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5D5P)

(-) Related Entries Specified in the PDB File

3brc 3wb0 3wb1 3wb2