Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF BPU1 BETA-LACTAMASE
 
Authors :  C. A. Smith, S. B. Vakulenko
Date :  24 Jul 15  (Deposition) - 25 Nov 15  (Release) - 05 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Hydrolase, Beta-Lactamase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Toth, N. T. Antunes, N. K. Stewart, H. Frase, M. Bhattacharya, C. A. Smith, S. B. Vakulenko
Class D Beta-Lactamases Do Exist In Gram-Positive Bacteria.
Nat. Chem. Biol. V. 12 9 2016
PubMed-ID: 26551395  |  Reference-DOI: 10.1038/NCHEMBIO.1950

(-) Compounds

Molecule 1 - BETA-LACTAMASE
    Chains: A, B
    EC Number: 3.5.2.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: BPUM_2340
    Organism Scientific: BACILLUS PUMILUS
    Organism Taxid: 1408

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
15R72Ligand/Ion(2~{S},3~{R})-3-METHYL-2-[(2~{S},3~{R})-3-OXIDANYL-1-OXIDANYLIDENE-BUTAN-2-YL]-4-[(3~{S},5~{S})-5-[(SULFAMOYLAMINO)METHYL]PYRROLIDIN-3-YL]SULFANYL-3,4-DIHYDRO-2~{H}-PYRROLE-5-CARBOXYLIC ACID
2FLC1Ligand/IonCITRATE ANION
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
15R71Ligand/Ion(2~{S},3~{R})-3-METHYL-2-[(2~{S},3~{R})-3-OXIDANYL-1-OXIDANYLIDENE-BUTAN-2-YL]-4-[(3~{S},5~{S})-5-[(SULFAMOYLAMINO)METHYL]PYRROLIDIN-3-YL]SULFANYL-3,4-DIHYDRO-2~{H}-PYRROLE-5-CARBOXYLIC ACID
2FLC1Ligand/IonCITRATE ANION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
15R71Ligand/Ion(2~{S},3~{R})-3-METHYL-2-[(2~{S},3~{R})-3-OXIDANYL-1-OXIDANYLIDENE-BUTAN-2-YL]-4-[(3~{S},5~{S})-5-[(SULFAMOYLAMINO)METHYL]PYRROLIDIN-3-YL]SULFANYL-3,4-DIHYDRO-2~{H}-PYRROLE-5-CARBOXYLIC ACID
2FLC-1Ligand/IonCITRATE ANION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:100 , SER A:101 , TRP A:136 , SER A:149 , VAL A:151 , GLY A:241 , SER A:242 , THR A:269 , HOH A:439 , HOH A:469 , HOH A:485binding site for residue 5R7 A 301
2AC2SOFTWAREHIS A:168 , ALA A:172 , HIS A:285 , HOH A:414 , HOH A:441 , HOH A:495 , HOH A:520 , HOH A:539binding site for residue FLC A 302
3AC3SOFTWAREPRO B:99 , GLN B:100 , THR B:102 , PHE B:103 , LYS B:104 , GLU B:132 , TRP B:136 , SER B:149 , VAL B:151 , LEU B:189 , LYS B:239 , THR B:240 , GLY B:241 , SER B:242 , HOH B:404binding site for Di-peptide 5R7 B 300 and SER B 101

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CTN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CTN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CTN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CTN)

(-) Exons   (0, 0)

(no "Exon" information available for 5CTN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:233
                                                                                                                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhh....eeeeeee......eeehhhhhh....hhhhhhhhhhhhhhhh........ee........hhhhh..eehhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhhh.....hhhhhhhhhhhheeeee..eeeeeeee....eeeeeeeeee..eeeeeeeeee.hhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ctn A  59 SIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFKVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV 291
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288   


Chain B from PDB  Type:PROTEIN  Length:232
                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhh....eeeeeee......eeehhhhhh....hhhhhhhhhhhhhhhh........ee........hhhhh..eehhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhhh.....hhhhhhhhhhhheeeee..eeeeeeee....eeeeeeeeee..eeeeeeeeee.hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ctn B  59 SIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFKVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEAS 290
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CTN)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CTN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CTN)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5R7  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ctn)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ctn
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A8FFI9_BACP2 | A8FFI9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.5.2.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A8FFI9_BACP2 | A8FFI9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A8FFI9_BACP2 | A8FFI9: 5ctm

(-) Related Entries Specified in the PDB File

5ctm