Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE ESTERASE DOMAIN FROM RHODOTHERMUS MARINUS RMAR_1206 PROTEIN
 
Authors :  J. Marles-Wright, C. Wardrope, M. -B. V. Jensen, L. E. Horsfall, P. D. To S. J. Rosser
Date :  16 Jul 15  (Deposition) - 27 Jul 16  (Release) - 30 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.56
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Serine Esterase Osmc Thermophile, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. V. Jensen, L. E. Horsfall, C. Wardrope, P. D. Togneri, J. Marles-Wright, S. J. Rosser
Characterisation Of A New Family Of Carboxyl Esterases With An Osmc Domain.
Plos One V. 11 66128 2016
PubMed-ID: 27851780  |  Reference-DOI: 10.1371/JOURNAL.PONE.0166128

(-) Compounds

Molecule 1 - OSMC FAMILY PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PDEST17
    Expression System Strain: AI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 1-255
    Gene: RMAR_1206
    Organism Scientific: RHODOTHERMUS MARINUS
    Organism Taxid: 29549
    Synonym: ESTERASE RMAR_1206

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PGE2Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1PGE1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1PGE1Ligand/IonTRIETHYLENE GLYCOL

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:217 , HOH A:483 , ALA B:209 , PHE B:212 , PHE B:221 , PGE B:301binding site for residue PGE A 301
2AC2SOFTWAREALA A:209 , GLN A:213 , PHE A:221 , PGE A:301 , HIS B:217 , HOH B:453binding site for residue PGE B 301

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:135 -A:210
2B:135 -B:210

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1His A:217 -Pro A:218
2His B:217 -Pro B:218

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CML)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CML)

(-) Exons   (0, 0)

(no "Exon" information available for 5CML)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:240
                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee.....eeeeeeee.......eeeeeeehhhhh..hhhhhhhhhhhhhh.eeeeeee.......hhhhhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhh....eeeee....hhhhhhh.eee.......eeee......eeeehhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhhhhhh...eeeee.........hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5cml A   1 MQIKTVTFENNRGERLAARLDLPVDTQPVAYALFAHCFTCSKNLKAVTTISRALTTQGYAVLRFDFTGLGATNFEDLRAACRFLSAQYEPPALLIGHSLGGAAVLAVAGEFPEVKAVATIGAPCDPAHVRHLLRPALDTTVGEAVVDLGGRPFRIKKQFLEELERVNLEDQVRTMRRPLLLFHSPTDQIVGIENAACLFQAARHPKSFVSLDQADHLLSNSDDAAFVGEVLGAWARRYVG 253
                                    10        20        30        40        50        60        70|       91       101       111       121       131       141       153       163       173       183       193       203       213       223       233       243       253
                                                                                                70|                                                                 150|                                                                                                    
                                                                                                 82                                                                  153                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....eeeeeee........eeeeeeehhhhh..hhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhh....eeeee....hhhhhhh.eee...eee......eee.hhhhhhhhhhhhh...eeeee........hhhhhhhhhhh...eeeee.........hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5cml B   2 QIKTVTFENNRGERLAARLDLPVDTQPVAYALFAHCFTCSKNLKAVTTISRALTTQGYAVLRFDFTGLGNFEDLRAACRFLSAQYEPPALLIGHSLGGAAVLAVAGEFPEVKAVATIGAPCDPAHVRHLLRPALEAVVDLGGRPFRIELERVNLEDQVRTMRRPLLLFHSPTDQIVGIENAACLFQAARHPKSFVSLDQADHLLSNSDDAAFVGEVLGAWARRYVG 253
                                    11        21        31        41        51        61        84        94       104       114       124       134       144   ||  161      |177       187       197       207       217       227       237       247      
                                                                                               70|                                                             148|         168|                                                                              
                                                                                                84                                                              156          175
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CML)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CML)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CML)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5CML)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PGE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:217 - Pro A:218   [ RasMol ]  
    His B:217 - Pro B:218   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cml
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D0MHY8_RHOM4 | D0MHY8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  D0MHY8_RHOM4 | D0MHY8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5CML)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5CML)