5C7Q - JenaLib

Asymmetric Unit (21, 21)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ARG A:64 , LYS A:78 , GOL A:207 , HOH A:310 , HOH A:344 , HOH A:383	binding site for residue SO4 A 201
02	AC2	SOFTWARE	TYR A:35 , THR A:36 , GLY A:179 , ARG B:18 , GLN B:138 , HOH B:302	binding site for residue SO4 A 202
03	AC3	SOFTWARE	ARG A:64 , HOH A:303 , HOH A:367 , HOH A:402 , ARG B:37 , HOH B:356 , HOH B:364	binding site for residue SO4 A 203
04	AC4	SOFTWARE	LEU A:51 , ARG A:127 , ASP A:128 , HOH A:305 , HOH A:316 , HOH A:366 , HOH A:401	binding site for residue GOL A 204
05	AC5	SOFTWARE	TYR A:19 , LEU A:20 , LEU A:41 , PRO A:43 , LYS A:78 , HOH A:315 , HOH A:323 , HOH A:345	binding site for residue GOL A 205
06	AC6	SOFTWARE	LYS A:69 , VAL A:70 , PHE A:71 , GLY A:159 , LYS A:160 , VAL A:161 , SER A:162 , HOH A:318 , HIS B:111	binding site for residue GOL A 206
07	AC7	SOFTWARE	HIS A:42 , ALA A:45 , GLU A:119 , LYS A:165 , SO4 A:201 , HOH A:351 , HOH A:377 , TYR B:116	binding site for residue GOL A 207
08	AC8	SOFTWARE	LYS A:105 , PHE A:106 , LEU A:107 , TRP A:172 , TRP A:181 , HOH A:394	binding site for residue PEG A 208
09	AC9	SOFTWARE	GLN A:24 , GLN A:26 , THR A:36 , PHE A:176 , ASN A:182 , HOH A:308 , HOH A:311 , ARG B:18	binding site for residue PEG A 209
10	AD1	SOFTWARE	HIS A:61 , VAL A:70 , HOH A:376	binding site for residue PG0 A 210
11	AD2	SOFTWARE	PRO A:30 , GLY A:32 , GLU B:5 , GLN B:28 , ALA B:29	binding site for residue PGE A 211
12	AD3	SOFTWARE	ARG A:37 , GLY A:115 , HOH A:312 , HOH A:339 , HOH A:341 , HOH A:343 , HOH A:356 , HOH A:420 , ARG B:64 , HOH B:346 , HOH B:358	binding site for residue SO4 A 212
13	AD4	SOFTWARE	ARG A:18 , TYR A:19 , HOH A:333 , TYR B:35 , THR B:36 , HOH B:306 , HOH B:392 , HOH B:394	binding site for residue SO4 A 213
14	AD5	SOFTWARE	ARG B:64 , GLY B:77 , LYS B:78 , GOL B:203 , HOH B:318 , HOH B:322 , HOH B:327 , HOH B:330 , HOH B:346 , HOH B:354	binding site for residue SO4 B 201
15	AD6	SOFTWARE	HIS A:111 , LYS B:69 , VAL B:70 , PHE B:71 , GLY B:159 , LYS B:160 , VAL B:161 , SER B:162 , PG0 B:207 , HOH B:334 , HOH B:409 , HOH B:421	binding site for residue GOL B 202
16	AD7	SOFTWARE	TYR A:116 , HIS B:42 , GLU B:119 , LYS B:165 , SO4 B:201 , HOH B:327 , HOH B:357 , HOH B:388	binding site for residue GOL B 203
17	AD8	SOFTWARE	ARG A:18 , HIS B:131 , HOH B:368 , HOH B:411	binding site for residue GOL B 204
18	AD9	SOFTWARE	HIS B:3 , LEU B:4 , GLU B:5	binding site for residue GOL B 205
19	AE1	SOFTWARE	TYR A:116 , HOH A:365 , TYR B:19 , LEU B:20 , HIS B:42 , PRO B:43 , LYS B:78 , HOH B:335 , HOH B:336 , HOH B:382	binding site for residue GOL B 206
20	AE2	SOFTWARE	HIS B:61 , VAL B:70 , VAL B:145 , GOL B:202	binding site for residue PG0 B 207
21	AE3	SOFTWARE	LYS B:105 , LEU B:107 , PHE B:176 , ASN B:182	binding site for residue PGE B 208

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:182
                                                                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.eeeeeeeeee....eeeeeeee.....eeeeeee....eeeeee......eeeeeeee....eeeee..eee.....hhhhhhhhhhhhhhheeeeeeeeeeee..........eeeeeeeeeee...........eeeeehhhhhhhhhhh....hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5c7q A   1 MKHLEEKTLSTRQIFKGRYLKIEQDQVQAPDGRTYTREYILHPGAAMMIPLLPNGNVVMIHQYRHAVKKVFLEFPAGKRDHNEETLLTAKRELLEETGYEAKDWKFLTTIHPVIGYSNEHIDLYLARDLTHLEQRLDQGEFIEVVEVKPADLMQLVLEGKVSDVKTQIGAFWLDKFLRGEWN 182
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Chain B from PDB  Type:PROTEIN  Length:180
                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeeeeee....eeeeeeee.....eeeeeee....eeeeeee.....eeeeeee......eeee..eee.....hhhhhhhhhhhhhhheeeeeeeeeeee..........eeeeeeeeeee...........eeeeehhhhhhhhhhh....hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5c7q B   3 HLEEKTLSTRQIFKGRYLKIEQDQVQAPDGRTYTREYILHPGAAMMIPLLPNGNVVMIHQYRHAVKKVFLEFPAGKRDHNEETLLTAKRELLEETGYEAKDWKFLTTIHPVIGYSNEHIDLYLARDLTHLEQRLDQGEFIEVVEVKPADLMQLVLEGKVSDVKTQIGAFWLDKFLRGEWN 182
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (2, 2)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PEG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PG0	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PGE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5c7q)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5c7q
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q6MIH8_BDEBA \| Q6MIH8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	3.6.1.13
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 21)

Sites (21, 21)