Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  RECOMBINANT INORGANIC PYROPHOSPHATASE FROM T BRUCEI BRUCEI
 
Authors :  A. Jamwal, M. Yogavel, A. Sharma
Date :  22 Jun 15  (Deposition) - 04 Nov 15  (Release) - 27 Jan 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Ef-Hand, Ppase Domain, Ca Binding Protein, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Jamwal, A. R. Round, L. Bannwarth, C. Venien-Bryan, H. Belrhali, M. Yogavel, A. Sharma
Structural And Functional Highlights Of Vacuolar Soluble Protein 1 From Pathogen Trypanosoma Brucei Brucei
J. Biol. Chem. V. 290 30498 2015
PubMed-ID: 26494625  |  Reference-DOI: 10.1074/JBC.M115.674176

(-) Compounds

Molecule 1 - ACIDOCALCISOMAL PYROPHOSPHATASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 73-414
    Gene: TB11.02.4910
    Organism Scientific: TRYPANOSOMA BRUCEI BRUCEI (STRAIN 927/4 GUTAT10.1)
    Organism Taxid: 185431
    Strain: 927/4 GUTAT10.1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 18)

Asymmetric Unit (5, 18)
No.NameCountTypeFull Name
12PN2Ligand/IonIMIDODIPHOSPHORIC ACID
2BR1Ligand/IonBROMIDE ION
3CL6Ligand/IonCHLORIDE ION
4EDO1Ligand/Ion1,2-ETHANEDIOL
5MG8Ligand/IonMAGNESIUM ION
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
12PN4Ligand/IonIMIDODIPHOSPHORIC ACID
2BR-1Ligand/IonBROMIDE ION
3CL-1Ligand/IonCHLORIDE ION
4EDO2Ligand/Ion1,2-ETHANEDIOL
5MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELYS A:237 , GLU A:239 , ARG A:259 , TYR A:270 , ASP A:291 , ASP A:293 , ASP A:296 , ASP A:323 , ASP A:328 , TYR A:368 , LYS A:369 , MG A:502 , MG A:503 , MG A:504 , MG A:505 , HOH A:603 , HOH A:612 , HOH A:631 , HOH A:637 , HOH A:646 , HOH A:647 , HOH A:662 , HOH A:670binding site for residue 2PN A 501
02AC2SOFTWAREASP A:323 , ASP A:328 , 2PN A:501 , MG A:503 , HOH A:631 , HOH A:637binding site for residue MG A 502
03AC3SOFTWAREASP A:291 , ASP A:296 , ASP A:328 , 2PN A:501 , MG A:502 , MG A:505 , HOH A:612 , HOH A:632binding site for residue MG A 503
04AC4SOFTWAREGLU A:239 , 2PN A:501 , HOH A:652 , HOH A:662 , HOH A:670binding site for residue MG A 504
05AC5SOFTWAREASP A:296 , 2PN A:501 , MG A:503 , HOH A:603 , HOH A:612 , HOH A:622 , HOH A:647binding site for residue MG A 505
06AC6SOFTWAREARG A:259 , GLN A:372 , HOH A:668binding site for residue CL A 506
07AC7SOFTWAREARG A:213 , MET A:221 , HOH A:671binding site for residue CL A 507
08AC8SOFTWAREHIS A:202 , LYS A:407binding site for residue CL A 508
09AC9SOFTWARELYS B:237 , GLU B:239 , ARG B:259 , TYR B:270 , ASP B:291 , ASP B:293 , ASP B:296 , ASP B:323 , ASP B:328 , TYR B:368 , LYS B:369 , MG B:502 , MG B:503 , MG B:504 , MG B:505 , HOH B:609 , HOH B:621 , HOH B:629 , HOH B:638 , HOH B:643 , HOH B:646 , HOH B:656 , HOH B:668binding site for residue 2PN B 501
10AD1SOFTWAREASP B:291 , ASP B:296 , ASP B:328 , 2PN B:501 , MG B:503 , MG B:505 , HOH B:622 , HOH B:643binding site for residue MG B 502
11AD2SOFTWAREASP B:296 , 2PN B:501 , MG B:502 , HOH B:605 , HOH B:613 , HOH B:643 , HOH B:668binding site for residue MG B 503
12AD3SOFTWAREGLU B:239 , 2PN B:501 , HOH B:609 , HOH B:638 , HOH B:656binding site for residue MG B 504
13AD4SOFTWAREASP B:323 , ASP B:328 , 2PN B:501 , MG B:502 , HOH B:621 , HOH B:646binding site for residue MG B 505
14AD5SOFTWARELYS B:314binding site for residue CL B 506
15AD6SOFTWAREARG B:259 , GLN B:372binding site for residue CL B 507
16AD7SOFTWARESER B:279binding site for residue CL B 508
17AD8SOFTWAREARG B:213 , MET B:221binding site for residue BR B 509
18AD9SOFTWAREGLU B:397binding site for residue EDO B 510

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5C5V)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Gly A:174 -Glu A:175
2Arg B:110 -Asn B:111
3Gly B:174 -Glu B:175

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5C5V)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5C5V)

(-) Exons   (0, 0)

(no "Exon" information available for 5C5V)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:342
                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.......eehhhhhhhhhhhhhhhh.hhhhhhhhhhhhh....eehhhhhhhhhh.hhhhhhhhhhhhhhhhh.....eeeeeeee........eeeeeeee.....eeeehhhhhh...................eeeeeee.......eee........eee.ee..ee..........eeee.......................eeee..........eeeeeeeeee.eee..ee..eeeeee............hhhhhhh.hhhhhhhhhhhhhhhhhh....ee.hhh.eeehhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5c5v A  73 TQPMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEINAIDGHVTFEKFWAWWCSHPVHSRTKCFSMVSADFSMPYHQQQLVVHEKGEMYTPSYRVLYFFRDLETGRERQVSPWHDIPLYVRDLVRTKPEATPMNRYNFICEIPKWTRAKFEIATGESFNPIKQDIKNGVPRFYKHGDMMWNYGAFPQTWESTEVLFEAGVTGDNDPVDAVEIGMTQFKVGQVSAVKVLGVLGMIDEGKMDWKVVCISHNDPICRFMKDIHDVPKFLPGCLDAIREWFRVYKICQGGEASHFAFDGEFKDKEYAMKVIDESHNMWHNLLKVNKRGEL 414
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412  


Chain B from PDB  Type:PROTEIN  Length:342
                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.........hhhhhhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee........eeeeeeee.....eeeehhhhhh...................eeeeeee.......eee........eee.ee..ee..........eeee.......................eeee..........eeeeeeeeee.eee..ee..eeeeee....hhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhh....ee.hhh.eeehhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5c5v B  73 TQPMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEINAIDGHVTFEKFWAWWCSHPVHSRTKCFSMVSADFSMPYHQQQLVVHEKGEMYTPSYRVLYFFRDLETGRERQVSPWHDIPLYVRDLVRTKPEATPMNRYNFICEIPKWTRAKFEIATGESFNPIKQDIKNGVPRFYKHGDMMWNYGAFPQTWESTEVLFEAGVTGDNDPVDAVEIGMTQFKVGQVSAVKVLGVLGMIDEGKMDWKVVCISHNDPICRFMKDIHDVPKFLPGCLDAIREWFRVYKICQGGEASHFAFDGEFKDKEYAMKVIDESHNMWHNLLKVNKRGEL 414
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5C5V)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5C5V)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5C5V)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2PN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg B:110 - Asn B:111   [ RasMol ]  
    Gly A:174 - Glu A:175   [ RasMol ]  
    Gly B:174 - Glu B:175   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5c5v
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q384W5_TRYB2 | Q384W5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q384W5_TRYB2 | Q384W5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5C5V)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5C5V)