5BY8 - JenaLib

Title :   THE STRUCTURE OF RPF2-RRS1 EXPLAINS ITS ROLE IN RIBOSOME BIOGENESIS

Authors :   S. Kharde, F. R. Calvino, A. Gumiero, K. Wild, I. Sinning

Date :   10 Jun 15 (Deposition) - 08 Jul 15 (Release) - 26 Aug 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.52

Chains :   Asym./Biol. Unit : A,B

Keywords :   Ribosome Biogenesis, Brix Domain, Protein-Rna Interaction, 5S Rnp, Protein Complex, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Kharde, F. R. Calvino, A. Gumiero, K. Wild, I. Sinning
The Structure Of Rpf2-Rrs1 Explains Its Role In Ribosome Biogenesis.
Nucleic Acids Res. V. 43 7083 2015
PubMed-ID: 26117542 | Reference-DOI: 10.1093/NAR/GKV640

Compounds

Molecule 1 - RPF2
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	ANIA_10200
	Organism Scientific	:	EMERICELLA NIDULANS FGSC A4
	Organism Taxid	:	227321

Molecule 2 - RRS1
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	AN3745.2, ANIA_03745
	Organism Scientific	:	EMERICELLA NIDULANS FGSC A4
	Organism Taxid	:	227321

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 10)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:231
                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee...hhhhhhhhhhhhhhh...eeeeee..........hhhhhhhhhhh...eeeeee.......eeeeeeee..eeeeeeeeee.........................eeeee.hhhhh..hhhhhhhhhhhhhhhh.....eee.hhh.eeeeeee.........eeeeeeeeeeee.......eeeeeeeeeeeeeeeeeee..hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5by8 A  23 LIEGAKRVLLLHGSKCPTPLHTVLKVFHSLTTPHSVLFHKKNENIHPFESTESLEFLANKNDCGmVIFGSSNKKRPNCLTIARIFDSKVLDmAELLLLPDANGEGIPEmNRLSmHVAIGLRPLmLFSGSAWDDTTSTTHTmLKSmLVDLFKGETSDKIDVEGLQYALmVGAEEPTAGLAPIIHLRWYKIVTKRSGHKLPRVELEEIGPKLDFKVGRIQEAPRDVmKEAmKQ 253
                                    32        42        52        62        72        82    |   92       102       112 |     122       132   |   142   |   152       162|   |  172       182       192       202       212       222       232       242    |  252 
                                                                                           87-MSE                    114-MSE          131-MSE|       146-MSE          163-MSE                    190-MSE                                                  247-MSE  
                                                                                                                                           136-MSE                        167-MSE                                                                             251-MSE

Chain B from PDB  Type:PROTEIN  Length:85
                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeehhh.eeee..........hhhhhhhhhhhhhhhhhhhhhhhhh.eeee..eeeee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 5by8 B  18 RLPITVSKPTPYTFDLGHLLANDPNPLELPKSEPLNASLKATARDGVQSLLNQLLTTCPITSSQQGVLLTLPAPSTILPRHKPLP 102
                                    27        37        47        57        67        77        87        97

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (18, 25)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 5by8)

	Cis Peptide Bonds
		Thr A:54 - Pro A:55	[ RasMol ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5by8
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	C8VMF9_EMENI \| C8VMF9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	Q5B6T5_EMENI \| Q5B6T5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	C8VMF9_EMENI \| C8VMF9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q5B6T5_EMENI \| Q5B6T5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description