Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE C-TERMINAL DOMAIN OF TAGH
 
Authors :  S. C. Chen, Y. Chen
Date :  26 May 15  (Deposition) - 06 Jul 16  (Release) - 06 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.68
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Transporter, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. P. Ko, S. T. Tseng, S. J. Lai, S. C. Chen, H. H. Guan, C. S. Yang, C. J. Chen, Y. Chen
Sh3-Like Motif-Containing C-Terminal Domain Of Staphylococcal Teichoic Acid Transporter Suggests Possible Function.
Proteins 2016
PubMed-ID: 27213893  |  Reference-DOI: 10.1002/PROT.25074

(-) Compounds

Molecule 1 - ABC TRANSPORTER, ATP-BINDING PROTEIN
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System Taxid511693
    FragmentUNP RESIDUES 327-505
    GeneSERP1409
    Organism ScientificSTAPHYLOCOCCUS EPIDERMIDIS (STRAIN ATCC 35984 / RP62A)
    Organism Taxid176279
    StrainATCC 35984 / RP62A

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5BND)

(-) Sites  (0, 0)

(no "Site" information available for 5BND)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5BND)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5BND)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5BND)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5BND)

(-) Exons   (0, 0)

(no "Exon" information available for 5BND)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....eee.....eee....eeeeeeee..eeeeee..eeeeee.hhheee......ee.....hhhhhhhhhhhhhhhhhh....hhhhhh...........eee......eeee.hhh.eeeeeee..hhhhhhh.......eeeeee..eeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5bnd A 327 TYEEKLAYGLALDGSVTLNGSKDLKVPKYSLITITGENNKRYRVEMNQRRYSVSKNQVFYFNPAGLYESHTFKKLSPYIKSNYSTYVEYFNSHLHQKHDKVTETLRPDKDKKYVVPITQQPIKMIFGDNDKLSGFVIPMTNKTELKKTFNITKDVWITKSGSGYFIADMKEEKWIYIEL 505
                                   336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496         

Chain B from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....eee.....eee....eeeeeeee..eeeeee..eeeeee.hhheee......ee.....hhhhhhhhhhhhhhhhhh....hhhhhh...........eee......eeee.hhh.eeeeeee..hhhhhhh.......eeeeee..eeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5bnd B 327 TYEEKLAYGLALDGSVTLNGSKDLKVPKYSLITITGENNKRYRVEMNQRRYSVSKNQVFYFNPAGLYESHTFKKLSPYIKSNYSTYVEYFNSHLHQKHDKVTETLRPDKDKKYVVPITQQPIKMIFGDNDKLSGFVIPMTNKTELKKTFNITKDVWITKSGSGYFIADMKEEKWIYIEL 505
                                   336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496         

Chain C from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.....eee.....eee....eeeeeee...eeeeee..eeeeee.hhheee......ee.....hhhhhhhhhhhhhhhhhh....hhhhhh...........eee......eeee.hhh.eeeeeee..hhhhhh........eeeeee..eeeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5bnd C 327 TYEEKLAYGLALDGSVTLNGSKDLKVPKYSLITITGENNKRYRVEMNQRRYSVSKNQVFYFNPAGLYESHTFKKLSPYIKSNYSTYVEYFNSHLHQKHDKVTETLRPDKDKKYVVPITQQPIKMIFGDNDKLSGFVIPMTNKTELKKTFNITKDVWITKSGSGYFIADMKEEKWIYIEL 505
                                   336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5BND)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5BND)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5BND)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5bnd)
 
  Sites
(no "Sites" information available for 5bnd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5bnd)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5bnd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5HN63_STAEQ | Q5HN63
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q5HN63_STAEQ | Q5HN63
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5BND)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5BND)