Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF CATALYTIC DOMAIN OF AUTOLYSIN FROM CLOSTRIDIUM PERFRINGENS
 
Authors :  E. Tamai, H. Sekiya, E. Goda, N. Makihata, J. Maki, H. Yoshida, S. Kamito
Date :  29 Nov 16  (Deposition) - 07 Dec 16  (Release) - 01 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.76
Chains :  Asym./Biol. Unit :  A
Keywords :  Autolysin, Glycoside Hydrolase 73 Family, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Tamai, H. Sekiya, E. Goda, N. Makihata, J. Maki, H. Yoshida, S. Kamitori
Structural And Biochemical Characterization Of The Clostridium Perfringens Autolysin Catalytic Domain
Febs Lett. V. 591 231 2017
PubMed-ID: 27926788  |  Reference-DOI: 10.1002/1873-3468.12515

(-) Compounds

Molecule 1 - N-ACETYLGLUCOSAMINIDASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentAUTOLYSIN CATALYTIC DOMAIN, UNP RESIDUES 871-1129
    GeneCPE1231
    Organism ScientificCLOSTRIDIUM PERFRINGENS (STRAIN 13 / TYPE A)
    Organism Taxid195102
    Strain13 / TYPE A
    SynonymPROBABLE SURFACE PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1EDO6Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:895 , ASN A:896 , ILE A:1090 , TRP A:1091 , GLN A:1093 , HOH A:1318 , HOH A:1331binding site for residue EDO A 1201
2AC2SOFTWAREASN A:1019 , LEU A:1020 , PHE A:1021 , ILE A:1023 , TRP A:1049 , ALA A:1055 , ALA A:1059binding site for residue EDO A 1202
3AC3SOFTWARETYR A:1043 , ARG A:1047 , GLY A:1058 , GLU A:1061 , HOH A:1313binding site for residue EDO A 1203
4AC4SOFTWARESER A:932 , SER A:936 , ASN A:1066 , EDO A:1205 , HOH A:1313binding site for residue EDO A 1204
5AC5SOFTWAREASN A:930 , LEU A:1065 , ASN A:1066 , EDO A:1204 , HOH A:1353binding site for residue EDO A 1205
6AC6SOFTWAREGLN A:968 , LEU A:1078 , MET A:1081 , TYR A:1100 , ALA A:1101 , ILE A:1104binding site for residue EDO A 1206

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5WQW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5WQW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5WQW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5WQW)

(-) Exons   (0, 0)

(no "Exon" information available for 5WQW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:254
                                                                                                                                                                                                                                                                                               
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...hhhhhhhhhhhhh....hhhhhhhhhhhhhh.hhhhhh........hhhhhhhhh..hhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhheeeeeeeeeeeeee.....eeeeeeeeeeeeeee................hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhh..hhhhh........hhhhhhhhhhhhhhhhh.......eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5wqw A  876 ASKTNYGVSLNEYIKLQQRNNPSNYSYSEFEKYINPAKATNKLQFLRIDKFRSVNVSGLSSRLSNKGVLTGQGQAFVNAAKAFNIDPIYLVAQCLHETGNGTSKLAKGVTITEIADESKPIYNGNGQLVGYHMIKLSKPVTVYNLFGIGAKDNSSVFPNRALILGTTYAYNRGWTSIENAIKGAAEFVSLNYVHSSRYSQNTLYKMRYNQNVSNIWHQYATTPWYASSIADIMRSYQDLYLENNFTFDVPVFAG 1129
                                   885       895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5WQW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5WQW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5WQW)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5wqw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5wqw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8XL11_CLOPE | Q8XL11
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8XL11_CLOPE | Q8XL11
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8XL11_CLOPE | Q8XL112kt8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5WQW)