Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE MEP2 MUTANT DELTA442 FROM CANDIDA ALBICANS
 
Authors :  B. Van Den Berg, A. Chembath, J. Rutherford
Date :  12 Feb 15  (Deposition) - 02 Mar 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.40
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Membrane Protein, Ammonium Transporter, Mep2 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Van Den Berg, A. Chembath, D. Jefferies, A. Basle, S. Khalid, J. Rutherford
Structural Basis For Mep2 Ammonium Transceptor Activation By Phosphorylation.
Nat. Commun. V. 7 11337 2016
PubMed-ID: 27088325  |  Reference-DOI: 10.1038/NCOMMS11337

(-) Compounds

Molecule 1 - MEP2
    Chains: A
    Engineered: YES
    Expression System: SACCHAROMYCES CEREVISIAE
    Expression System Common: BAKER'S YEAST
    Expression System Plasmid: 83NU
    Expression System Strain: W303 DELTA PEP4
    Expression System Taxid: 4932
    Expression System Vector Type: PLASMID
    Organism Scientific: CANDIDA ALBICANS
    Organism Taxid: 5476

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5AID)

(-) Sites  (0, 0)

(no "Site" information available for 5AID)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5AID)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5AID)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5AID)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5AID)

(-) Exons   (0, 0)

(no "Exon" information available for 5AID)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:398
                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhh............hhhhh............hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5aid A   4 QFTGTGTGGDVFKVDLNEQFDRADMVWIGTASVLVWIMIPGVGLLYSGISRKHALSLMWAALMAACVAAFQWFWWGYSLVFAHNGSVFLGTLQNFCLKDVLGAPSIVKTVPDILFCLYQGMFAAVTAILMAGAGCERARLGPMMVFLFIWLTVVYCPIAYWTWGGNGWLVSLGALDFAGGGPVHENSGFAALAYSLWLGKPHSVSSIVMGTIFLWFGWYGFNGGSTGNSSMRSWYACVNTNLAAATGGLTWMLVDWFRTGGKWSTVGLCMGAIAGLVGITPAAGYVPVYTSVIFGIVPAIICNFAVDLKDLLQIDDGMDVWALHGVGGFVGNFMTGLFAADYVAMIDGTEIDGGWMNHHWKQLGYQLAGSCAVAAWSFTVTSIILLAMDRIPFLRIRL 416
                                    13        23        33        43        53 ||     64        74        84        94       104       114       124       134       144       154       164       174       184       194       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408        
                                                                              55|                                                                                                                                               203|                                                                                                                                                                                                      
                                                                               57                                                                                                                                                218
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5AID)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5AID)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5AID)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5aid)
 
  Sites
(no "Sites" information available for 5aid)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5aid)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5aid
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q59UP8_CANAL | Q59UP8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q59UP8_CANAL | Q59UP8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q59UP8_CANAL | Q59UP8: 5aez 5af1 5ah3 5fuf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5AID)