Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  POLYCYCLIC KETONE MONOOXYGENASE FROM THE THERMOPHILIC FUNGUS THERMOTHELOMYCES THERMOPHILA
 
Authors :  S. Savino, M. J. L. J. Furst, M. W. Fraaije, A. Mattevi
Date :  20 Dec 16  (Deposition) - 11 Jan 17  (Release) - 25 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Flavin, Monooxygenase, Baeyer-Villiger, Oxygen, Biocatalysis, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. J. Furst, S. Savino, H. M. Dudek, J. R. Gomez Castellanos, C. Gutierrez De Souza, S. Rovida, M. W. Fraaije, A. Mattevi
Polycyclic Ketone Monooxygenase From The Thermophilic Fungu Thermothelomyces Thermophila: A Structurally Distinct Biocatalyst For Bulky Substrates.
J. Am. Chem. Soc. V. 139 627 2017
PubMed-ID: 28010060  |  Reference-DOI: 10.1021/JACS.6B12246

(-) Compounds

Molecule 1 - PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE-LIKE PROTEIN
    Atcc: 42464
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PET-HIS6-SUMO
    Expression System Vector Type: PLASMID
    Gene: MYCTH_65400
    Organism Scientific: MYCELIOPHTHORA THERMOPHILA
    Organism Taxid: 78579

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2GOL1Ligand/IonGLYCEROL
3NDP1Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:84 , GLY A:85 , GLY A:87 , TYR A:88 , GLY A:89 , ASP A:113 , ALA A:114 , GLY A:120 , THR A:121 , TRP A:124 , CYS A:132 , ASP A:133 , VAL A:134 , TYR A:139 , SER A:181 , ASN A:182 , VAL A:183 , ALA A:222 , SER A:223 , GLY A:224 , THR A:227 , ARG A:426 , TYR A:478 , THR A:492 , VAL A:494 , ALA A:539 , ASN A:540 , ASN A:541 , NDP A:701 , HOH A:804 , HOH A:860 , HOH A:886 , HOH A:905 , HOH A:936 , HOH A:1030 , HOH A:1036binding site for residue FAD A 700
2AC2SOFTWAREPHE A:42 , PRO A:232 , ILE A:275 , GLY A:276 , THR A:277 , GLY A:278 , ALA A:279 , THR A:280 , ARG A:300 , THR A:301 , LYS A:425 , ARG A:426 , GLY A:451 , VAL A:452 , SER A:475 , THR A:476 , GLY A:477 , TYR A:478 , TYR A:600 , FAD A:700 , HOH A:833 , HOH A:843 , HOH A:877 , HOH A:879 , HOH A:884 , HOH A:899 , HOH A:902 , HOH A:948 , HOH A:980binding site for residue NDP A 701
3AC3SOFTWAREALA A:396 , VAL A:399 , ARG A:400 , ALA A:418 , TYR A:420 , THR A:422 , HOH A:827 , HOH A:845binding site for residue GOL A 702

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:424 -A:596

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5MQ6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MQ6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MQ6)

(-) Exons   (0, 0)

(no "Exon" information available for 5MQ6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:636
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh....hhhh.eee.hhh.hhhhhhhhh....hhhhhhh........eeeeeee..hhhhhhhhhhhhhh........eeee.......hhhhhh.........hhhhhh.hhhhhh........hhhhhhhhhhhhhhhh.....ee..eeeeeeeee....eeeeeeee........eeeeeeeeeeee........eee...hhhhh...eee.hhhhhhhhh.......hhhhh..eeeee..hhhhhhhhhhhhh...eeeeee.....ee.......hhhhhhhhh....hhhhhhhhhhhhhhh............hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh...hhhhh..ee..hhhhhh....eeeee.......eee..eeee..eeee..eeee.......hhhhhhhhhhhh.eeehhhhhhhhhhhhhhh..............eee..........hhhhhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhhhhhhhhhh....hhhhh.....hhhhhhhh......hhhhhhhhhhhhhh......eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mq6 A  14 PEDLKLHQLSQKYTAEAAKRFRPEGLGQFIRLKEVGNERFRALAEDPWVDHAALNAKEPVKDGSRYKFIILGAGYGGLLYAVRLAEAGLASGPDDILMVDAAGGFGGTWWWNRYPGLHCDVESYSYMPLLEETGYIPKSKYAAGPELLEHAYRIATQWKLHDKALFRSNVKTIRWDDESRLWSLEVTEGRGPGQQSRELKLQARYVLLASGILTNPQVPKIPGLETFTGPVFHTARWNYDVTGGSPTDEALNRLEGKRVGIIGTGATAIQVVPKLAKYAKELYVFQRTPSGVWWRGQRPTDPVEWKTKIARKKGWQRERMLNLDSYLTDAAEEGQENMVADGWTEMPAFSAVIGSPRHGIVEPTPEKIAEHLGRLYKLDLPHAEQVRARTDSIVKDPKTAAKLKAWYPTWCKRPTFSDEYLQTFNLPNVHLVDTDGKGVDAANPSGLVVADKEYPLDILVLSTGYVTPSIGGGSPAVRTGVDIYGRGGKSLDDKWQTHGAATLHGVCSNGFPNLFFTPLSQSSQAANNAFTLDVGTEHIVQVIKTAEDRVDGDALVEVTSEAEEAWSFEIMKHAGWFASVTGCTPGYITSEGEAPMEMAKRARSGNLSQGMASYMKLLQEYRADGSLKGFDISSRA 655
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603   ||  619       629       639       649      
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           607|                                         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            614
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MQ6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MQ6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MQ6)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5mq6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mq6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G2QA95_MYCTT | G2QA95
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G2QA95_MYCTT | G2QA95
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5MQ6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MQ6)