Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HUMAN SIRT6 IN COMPLEX WITH ACTIVATOR UBCS38
 
Authors :  C. Steegborn, W. You, C. Kambach
Date :  21 Nov 16  (Deposition) - 28 Dec 16  (Release) - 25 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.07
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  4-(Pyridin-3-Yl)-5-((3-(Trifluoromethyl)Phenyl)Sulfonyl)-4, 5- Dihydropyrrolo[1, 2-A]Quinoxaline, Drug, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. You, D. Rotili, T. M. Li, C. Kambach, M. Meleshin, M. Schutkowski, K. F. Chua, A. Mai, C. Steegborn
Structural Basis Of Sirtuin 6 Activation By Synthetic Small Molecules.
Angew. Chem. Int. Ed. Engl. V. 56 1007 2017
PubMed-ID: 27990725  |  Reference-DOI: 10.1002/ANIE.201610082

(-) Compounds

Molecule 1 - NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-6
    Chains: A, B
    EC Number: 3.5.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET151-D-TOPO
    Expression System Taxid: 562
    Expression System Variant: ROSETTA2 (DE3) PLYSS
    Expression System Vector Type: PLASMID
    Gene: SIRT6, SIR2L6
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: REGULATORY PROTEIN SIR2 HOMOLOG 6,SIR2-LIKE PROTEIN 6

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 16)

Asymmetric Unit (5, 16)
No.NameCountTypeFull Name
17N21Ligand/Ion(4~{R})-4-PYRIDIN-3-YL-5-[3-(TRIFLUOROMETHYL)PHENYL]SULFONYL-4~{H}-PYRROLO[1,2-A]QUINOXALINE
2AR62Ligand/Ion[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGENPHOSPHATE
3EDO2Ligand/Ion1,2-ETHANEDIOL
4SO49Ligand/IonSULFATE ION
5ZN2Ligand/IonZINC ION
Biological Unit 1 (4, 8)
No.NameCountTypeFull Name
17N21Ligand/Ion(4~{R})-4-PYRIDIN-3-YL-5-[3-(TRIFLUOROMETHYL)PHENYL]SULFONYL-4~{H}-PYRROLO[1,2-A]QUINOXALINE
2AR61Ligand/Ion[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGENPHOSPHATE
3EDO1Ligand/Ion1,2-ETHANEDIOL
4SO45Ligand/IonSULFATE ION
5ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 6)
No.NameCountTypeFull Name
17N2-1Ligand/Ion(4~{R})-4-PYRIDIN-3-YL-5-[3-(TRIFLUOROMETHYL)PHENYL]SULFONYL-4~{H}-PYRROLO[1,2-A]QUINOXALINE
2AR61Ligand/Ion[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGENPHOSPHATE
3EDO1Ligand/Ion1,2-ETHANEDIOL
4SO44Ligand/IonSULFATE ION
5ZN-1Ligand/IonZINC ION

(-) Sites  (16, 16)

Asymmetric Unit (16, 16)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:52 , ALA A:53 , GLY A:54 , THR A:57 , ASP A:63 , PHE A:64 , ARG A:65 , TRP A:71 , GLN A:113 , HIS A:133 , GLY A:214 , THR A:215 , SER A:216 , ILE A:219 , ASN A:240 , LEU A:241 , GLN A:242 , GLY A:256 , TYR A:257 , VAL A:258 , HOH A:507 , HOH A:510 , HOH A:525 , HOH A:538 , ASP B:83binding site for residue AR6 A 401
02AC2SOFTWARECYS A:141 , CYS A:144 , CYS A:166 , CYS A:177binding site for residue ZN A 402
03AC3SOFTWAREARG A:90 , ALA A:275 , TRP A:276 , HOH A:505 , ARG B:90 , ALA B:275 , TRP B:276binding site for residue SO4 A 403
04AC4SOFTWAREVAL A:154 , GLY A:155 , ARG A:164 , LYS A:296binding site for residue SO4 A 404
05AC5SOFTWARELYS A:33 , ARG A:253 , HIS A:255binding site for residue SO4 A 405
06AC6SOFTWAREARG A:220 , PRO A:221 , ASN A:224binding site for residue SO4 A 406
07AC7SOFTWAREARG A:205 , ARG A:232 , ARG B:205binding site for residue SO4 A 407
08AC8SOFTWAREASP A:187binding site for residue EDO A 408
09AC9SOFTWARELYS A:15 , ILE A:61 , PRO A:62 , PHE A:64 , VAL A:70 , TRP A:71 , PHE A:86 , MET A:136 , MET A:157 , TRP A:188binding site for residue 7N2 A 409
10AD1SOFTWAREASP A:83 , GLY B:52 , ALA B:53 , GLY B:54 , THR B:57 , ASP B:63 , PHE B:64 , ARG B:65 , GLN B:113 , HIS B:133 , TRP B:188 , GLY B:214 , THR B:215 , SER B:216 , ILE B:219 , ASN B:240 , LEU B:241 , GLN B:242 , GLY B:256 , TYR B:257 , VAL B:258 , HOH B:504 , HOH B:506 , HOH B:516 , HOH B:530binding site for residue AR6 B 401
11AD2SOFTWARECYS B:141 , CYS B:144 , CYS B:166 , CYS B:177binding site for residue ZN B 402
12AD3SOFTWAREHIS A:68 , LYS A:81 , HIS B:68 , LYS B:81binding site for residue SO4 B 403
13AD4SOFTWARELYS B:33 , ARG B:253 , HIS B:255binding site for residue SO4 B 404
14AD5SOFTWAREVAL B:154 , GLY B:155 , THR B:162 , ARG B:164 , LYS B:296binding site for residue SO4 B 405
15AD6SOFTWAREARG B:220 , PRO B:221 , ASN B:224binding site for residue SO4 B 406
16AD7SOFTWAREPHE A:82 , TYR B:257 , HOH B:509binding site for residue EDO B 407

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5MGN)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Arg A:220 -Pro A:221
2Arg B:220 -Pro B:221

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MGN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MGN)

(-) Exons   (0, 0)

(no "Exon" information available for 5MGN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:282
                                                                                                                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh........hhhhhhhh...............hhhhhhhhhhhhh....eeee....hhhhhh..hhh.eee......eeee.....eee...........eeeee.......eeee.........hhhhhhhhhhhhhhh.eeeee.......hhhhhhhhhhhhhheeeee......hhhhh.eee..hhhhhhhhhhhhhh............................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5mgn A  10 PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE 298
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169|      186       196       206       216       226       236       246       256       266       276       286       296  
                                                                                                                                                                                         169|                                                                                                                         
                                                                                                                                                                                          177                                                                                                                         


Chain B from PDB  Type:PROTEIN  Length:275
                                                                                                                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh........hhhhhhhh...............hhhhhhhhhhhhh....eeee....hhhhheeee...eee......eeee.....eee...........eeeee.......eeee.........hhhhhhhhhhhhhhh.eeeee.......hhhhhhhhhhh...eeeee......hhhhh.eee..hhhhhhhhhhhhhh.........eee.............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mgn B  15 KGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK 296
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164    || 181       191       201       211       221       231       241       251       261       271       281       291     
                                                                                                                                                                                    169|                                                                                                                       
                                                                                                                                                                                     177
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MGN)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MGN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MGN)

(-) Gene Ontology  (35, 35)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7N2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    AR6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:220 - Pro A:221   [ RasMol ]  
    Arg B:220 - Pro B:221   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mgn
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SIR6_HUMAN | Q8N6T7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SIR6_HUMAN | Q8N6T7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SIR6_HUMAN | Q8N6T7: 3k35 3pki 3pkj 3zg6 5mf6 5mfp 5mfz

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MGN)