Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  OCEANOBACILLUS IHEYENSIS MACRODOMAIN MUTANT D40A
 
Authors :  F. Gil-Ortiz, R. Zapata-Perez, A. B. Martinez, J. Juanhuix, A. Sanchez
Date :  20 Jun 16  (Deposition) - 03 May 17  (Release) - 10 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Macrodomain, Adp-Ribosylation, Deacetylase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zapata-Perez, F. Gil-Ortiz, A. B. Martinez-Monino, A. G. Garcia-Saura, J. Juanhuix, A. Sanchez-Ferrer
Structural And Functional Analysis Of Oceanobacillus Iheyensis Macrodomain Reveals A Network Of Waters Involved In Substrate Binding And Catalysis.
Open Biol V. 7 2017
PubMed-ID: 28446708  |  Reference-DOI: 10.1098/RSOB.160327

(-) Compounds

Molecule 1 - MACROD-TYPE MACRODOMAIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28-MACROD
    Expression System Taxid: 562
    Expression System Variant: ROSSETTA 2
    Expression System Vector Type: PLASMID
    Gene: OB2288
    Mutation: YES
    Organism Scientific: OCEANOBACILLUS IHEYENSIS (STRAIN DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
    Organism Taxid: 221109
    Other Details: ENGINEERED MUTANT D40A
    Strain: DSM 14371 / JCM 11309 / KCTC 3954 / HTE831

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5LCC)

(-) Sites  (0, 0)

(no "Site" information available for 5LCC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5LCC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5LCC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LCC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LCC)

(-) Exons   (0, 0)

(no "Exon" information available for 5LCC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:189
                                                                                                                                                                                                                             
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..eeeeeee.hhhhh...eeeee.........hhhhhhhhhhhhhhhhhhhhhhhh...........eeeee.......eeeee..........hhhhhhhhhhhhhhhhhhhh...eeee..........hhhhhhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5lcc A  -3 HMASMKHNINDNTLEIVVGDITKETTNVIVNAANGSLLGGGGVAGAIHHAAGPELLKACQEMRNNELNGEELPTGEVIITSGFQLPSRFIIHTVGPIWNQTPDLQEELLANCYRNALELVKVKKLSSISFPSISTGVYGYPIHEAAAIALQTIIQFLQENDVGLVKVVLFSERDYSIYQEKLKYLIEKI 185
                                     6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176         


Chain B from PDB  Type:PROTEIN  Length:188
                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee..eeeeeee.hhhhh...eeeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeee.......eeeeee.........hhhhhhhhhhhhhhhhhhhhh..eeee....hhhhh.hhhhhhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5lcc B  -2 MASMKHNINDNTLEIVVGDITKETTNVIVNAANGSLLGGGGVAGAIHHAAGPELLKACQEMRNNELNGEELPTGEVIITSGFQLPSRFIIHTVGPIWNQTPDLQEELLANCYRNALELVKVKKLSSISFPSISTGVYGYPIHEAAAIALQTIIQFLQENDVGLVKVVLFSERDYSIYQEKLKYLIEKI 185
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LCC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LCC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LCC)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5LCC)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5lcc)
 
  Sites
(no "Sites" information available for 5lcc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5lcc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5lcc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8EP31_OCEIH | Q8EP31
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8EP31_OCEIH | Q8EP31
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q8EP31_OCEIH | Q8EP31: 5fud 5l9k 5l9q 5lau 5lbp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5LCC)