Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  THERMOSTABLE MUTANT OF HALOHYDRIN DEHALOGENASE (HHEC)
 
Authors :  M. Dal Lago, A. C. Terwisscha Van Scheltinga
Date :  14 Jul 16  (Deposition) - 11 Jan 17  (Release) - 03 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Thermostable Mutant, Engineered Mutant, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Arabnejad, M. Dal Lago, P. A. Jekel, R. J. Floor, A. W. H. Thunnissen A. C. Terwisscha Van Scheltinga, H. J. Wijma, D. B. Janssen
A Robust Cosolvent-Compatible Halohydrin Dehalogenase By Computational Library Design.
Protein Eng. Des. Sel. V. 30 173 2017
PubMed-ID: 27999093  |  Reference-DOI: 10.1093/PROTEIN/GZW068

(-) Compounds

Molecule 1 - HALOHYDRIN DEHALOGENASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI MC1061
    Expression System Plasmid: PBAD
    Expression System Taxid: 1211845
    Expression System Vector Type: PLASMID
    Gene: HHEC
    Mutation: YES
    Organism Common: AGROBACTERIUM TUMEFACIENS
    Organism Scientific: RHIZOBIUM RADIOBACTER
    Organism Taxid: 358

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 15)

Asymmetric Unit (4, 15)
No.NameCountTypeFull Name
1CL5Ligand/IonCHLORIDE ION
2EDO6Ligand/Ion1,2-ETHANEDIOL
3IMD2Ligand/IonIMIDAZOLE
4NA2Ligand/IonSODIUM ION
Biological Unit 1 (2, 16)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO12Ligand/Ion1,2-ETHANEDIOL
3IMD4Ligand/IonIMIDAZOLE
4NA-1Ligand/IonSODIUM ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:176 , TYR A:177 , LEU A:178 , TYR A:187 , IMD A:302binding site for residue CL A 301
02AC2SOFTWARESER A:132 , THR A:134 , TYR A:145 , PRO A:175 , ASN A:176 , PHE A:186 , TYR A:187 , CL A:301binding site for residue IMD A 302
03AC3SOFTWARESER A:55 , HOH A:410 , HOH A:435 , HOH A:579 , HOH A:587binding site for residue NA A 303
04AC4SOFTWAREGLU A:58 , GLU A:61 , LYS B:38binding site for residue CL A 304
05AC5SOFTWARELYS A:10 , HIS A:11 , PHE A:12 , GLY A:14 , MET A:15 , SER A:180 , GLU A:181 , GLN A:214binding site for residue EDO A 305
06AC6SOFTWARETRP A:192 , HIS A:198 , HOH A:507 , HOH A:536 , HOH A:562 , THR B:190 , THR B:194binding site for residue EDO A 306
07AC7SOFTWAREPRO A:184 , PRO B:196 , HOH B:452binding site for residue EDO A 307
08AC8SOFTWAREARG A:98 , VAL A:101 , GLU A:102 , GLU B:102binding site for residue EDO A 308
09AC9SOFTWAREASN B:176 , TYR B:177 , LEU B:178 , TYR B:187 , IMD B:302binding site for residue CL B 301
10AD1SOFTWARESER B:132 , TYR B:145 , PRO B:175 , ASN B:176 , PHE B:186 , CL B:301binding site for residue IMD B 302
11AD2SOFTWAREGLN B:57 , GLU B:58binding site for residue CL B 303
12AD3SOFTWAREHIS B:179 , THR B:213 , GLN B:214binding site for residue CL B 304
13AD4SOFTWARESER B:55 , HOH B:438 , HOH B:454 , HOH B:563 , HOH B:566 , HOH B:597binding site for residue NA B 305
14AD5SOFTWARELYS B:10 , HIS B:11 , PHE B:12 , GLY B:14 , MET B:15 , SER B:180 , GLU B:181 , GLN B:214binding site for residue EDO B 306
15AD6SOFTWAREASN B:157 , GLY B:234 , GLN B:235 , ILE B:236 , TRP B:238 , HOH B:518binding site for residue EDO B 307

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KVC)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Tyr A:185 -Phe A:186
2Thr A:190 -Pro A:191
3Phe A:243 -Pro A:244
4Tyr B:185 -Phe B:186
5Thr B:190 -Pro B:191
6Phe B:243 -Pro B:244

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KVC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KVC)

(-) Exons   (0, 0)

(no "Exon" information available for 5KVC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:254
                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee......hhhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhh...ee....hhhhhhhhhhhhhh...eeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee............hhhhhh.hhhhhhhhhhhh......hhhhhhhhhhhhhh..hhhhh..eeee............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kvc A   1 HATAIVTNVKHFGGMGSALRLSEAGHTVLCHDESFKQKKELEAFAETYPQLKPMSEQEPAELIRAVTRAYGQVDVLVSNDIFAPEFRPIDKYTVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGANTLANVLSKELGEYNIPVFAIGPNYLHSEDSPYFYPTTPWKTNPKHIAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQIFWLAGGFPMIERWPGMPE 254
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250    


Chain B from PDB  Type:PROTEIN  Length:254
                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee......hhhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhh..eee....hhhhhhhhhhhhhh...eeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee............hhhhhh.hhhhhhhhhhhh......hhhhhhhhhhhhhh..hhhhh..eeee............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5kvc B   1 HATAIVTNVKHFGGMGSALRLSEAGHTVLCHDESFKQKKELEAFAETYPQLKPMSEQEPAELIRAVTRAYGQVDVLVSNDIFAPEFRPIDKYTVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGANTLANVLSKELGEYNIPVFAIGPNYLHSEDSPYFYPTTPWKTNPKHIAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQIFWLAGGFPMIERWPGMPE 254
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KVC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KVC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KVC)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5KVC)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:243 - Pro A:244   [ RasMol ]  
    Phe B:243 - Pro B:244   [ RasMol ]  
    Thr A:190 - Pro A:191   [ RasMol ]  
    Thr B:190 - Pro B:191   [ RasMol ]  
    Tyr A:185 - Phe A:186   [ RasMol ]  
    Tyr B:185 - Phe B:186   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kvc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q93D82_RHIRD | Q93D82
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q93D82_RHIRD | Q93D82
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q93D82_RHIRD | Q93D82: 1pwx 1pwz 1px0 1zmt 1zo8 3zn2 4ixt 4ixw 4iy1 5kwe

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5KVC)