Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL BASIS FOR INHIBITOR-INDUCED AGGREGATION OF HIV-1 INTEGRASE
 
Authors :  K. Gupta, V. Turkki, S. Sherrill-Mix, Y. Hwang, G. Eilers, L. Taylor, C. P. Wang, D. Temelkoff, R. Nolte, E. Velthuisen, J. Jeffrey, G. D. Van D F. D. Bushman
Date :  19 Jan 16  (Deposition) - 14 Dec 16  (Release) - 21 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  4.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Biol. Unit 2:  A,B  (1x)
Keywords :  Integrase, Inhibitor Complex, Nucleic Acid Binding, Dna Integration, Transferase-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Gupta, V. Turkki, S. Sherrill-Mix, Y. Hwang, G. Eilers, L. Taylor, C. Mcdanal, P. Wang, D. Temelkoff, R. T. Nolte, E. Velthuisen, J. Jeffrey, G. D. Van Duyne, F. D. Bushman
Structural Basis For Inhibitor-Induced Aggregation Of Hiv Integrase.
Plos Biol. V. 14 02584 2016
PubMed-ID: 27935939  |  Reference-DOI: 10.1371/JOURNAL.PBIO.1002584

(-) Compounds

Molecule 1 - INTEGRASE
    Chains: A, B
    EC Number: 2.7.7.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Mutation: YES
    Organism Scientific: HUMAN IMMUNODEFICIENCY VIRUS 1
    Organism Taxid: 11676
    Strain: NL4-3

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB
Biological Unit 2 (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
12SQ2Ligand/Ion(2S)-TERT-BUTOXY[4-(8-FLUORO-5-METHYL-3,4-DIHYDRO-2H-CHROMEN-6-YL)-2-METHYL-1-OXO-1,2-DIHYDROISOQUINOLIN-3-YL]ETHANOIC ACID
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
12SQ4Ligand/Ion(2S)-TERT-BUTOXY[4-(8-FLUORO-5-METHYL-3,4-DIHYDRO-2H-CHROMEN-6-YL)-2-METHYL-1-OXO-1,2-DIHYDROISOQUINOLIN-3-YL]ETHANOIC ACID
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
12SQ2Ligand/Ion(2S)-TERT-BUTOXY[4-(8-FLUORO-5-METHYL-3,4-DIHYDRO-2H-CHROMEN-6-YL)-2-METHYL-1-OXO-1,2-DIHYDROISOQUINOLIN-3-YL]ETHANOIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:168 , ALA A:169 , GLU A:170 , HIS A:171 , THR A:174 , MET A:178 , ALA B:98 , LEU B:102 , THR B:124 , THR B:125 , ALA B:129 , TRP B:132 , TYR B:226 , TRP B:235 , LYS B:266binding site for residue 2SQ A 301
2AC2SOFTWAREGLN A:95 , ALA A:98 , THR A:124 , THR A:125 , ALA A:128 , ALA A:129 , TRP A:132 , TYR A:226 , TRP A:235 , ARG A:269 , ALA B:169 , GLU B:170 , HIS B:171 , THR B:174 , MET B:178binding site for residue 2SQ B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HOT)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:237 -Pro A:238
2Gly B:237 -Pro B:238

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HOT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HOT)

(-) Exons   (0, 0)

(no "Exon" information available for 5HOT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.eeee....eeee...........eee...hhhhhhhhhhhhhhhh...eee..........hhhhhhhhh..eee...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhheeee........eeeeeeeee...eeeee....eeeee...ee......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hot A  56 CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQM 275
                                    65        75        85        95       105       115       125       135   ||  151       161       171       181      |196       206       216       226       236       246       256       266         
                                                                                                             139|                                       188|                                                                                 
                                                                                                              146                                        194                                                                                 


Chain B from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee....eeeeeee........eee...hhhhhhhhhhhhhhhh...eee........hhhhhhhhhhhh.ee...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhheeee............eeee.....eeee.....eee....eeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hot B  56 CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQENPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMA 276
                                    65        75        85        95       105       115       125       135  ||   150       160       170       180      |193       203       213       223       233       243       253       263       273   
                                                                                                            138|                                        187|                                                                                     
                                                                                                             144                                         191
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HOT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HOT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HOT)

(-) Gene Ontology  (23, 23)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2SQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:237 - Pro A:238   [ RasMol ]  
    Gly B:237 - Pro B:238   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hot
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q72498_9HIV1 | Q72498
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q72498_9HIV1 | Q72498
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q72498_9HIV1 | Q72498: 1k6y 3ao2
UniProtKB/TrEMBL
        Q72498_9HIV1 | Q72498: 3ao1 3ao3 3ao4 3ao5 3l3u 3l3v 3ovn 3vq4 3vq5 3vq6 3vq7 3vq8 3vq9 3vqa 3vqb 3vqc 3vqd 3vqe 3vqp 3vqq

(-) Related Entries Specified in the PDB File

5hrn 5hrp 5hrr 5hrs