Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CYP153D17 FROM SPHINGOMONAS SP. PAMC 26605
 
Authors :  C. W. Lee, J. H. Lee
Date :  13 Oct 16  (Deposition) - 11 Jan 17  (Release) - 11 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym./Biol. Unit :  A
Keywords :  P450, Alkane Hydroxylase, Cyp153D17, Sphingomonas Sp. Pamc 26605, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. W. Lee, S. C. Yu, J. H. Lee, S. H. Park, H. Park, T. J. Oh, J. H. Lee
Crystal Structure Of A Putative Cytochrome P450 Alkane Hydroxylase (Cyp153D17) From Sphingomonas Sp. Pamc 26605 An Its Conformational Substrate Binding
Int J Mol Sci V. 17 2016
PubMed-ID: 27941697  |  Reference-DOI: 10.3390/IJMS17122067

(-) Compounds

Molecule 1 - PUTATIVE CYP ALKANE HYDROXYLASE CYP153D17
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: SPHINGOMONAS SP. PAMC 26605
    Organism Taxid: 1112214

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1D121Ligand/IonDODECANE
2HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:61 , PHE A:91 , ILE A:92 , HIS A:99 , ARG A:103 , PHE A:110 , GLY A:245 , THR A:249 , THR A:253 , ARG A:297 , ALA A:348 , PHE A:349 , GLY A:350 , HIS A:351 , HIS A:354 , ARG A:355 , CYS A:356 , VAL A:357 , GLY A:358 , ALA A:362 , D12 A:502binding site for residue HEM A 501
2AC2SOFTWARETHR A:74 , MET A:90 , ALA A:175 , LEU A:241 , GLY A:245 , PHE A:393 , HEM A:501binding site for residue D12 A 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5H1Z)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1His A:42 -Ser A:43
2Phe A:160 -Pro A:161

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5H1Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5H1Z)

(-) Exons   (0, 0)

(no "Exon" information available for 5H1Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:400
                                                                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhh..hhhhhhhhhhhh.eeee.......eeee.hhhhhhhhhh....ee.....................hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eehhhhh.hhhhhhhhhhhh.....hhhhhhh..................hhhhhhhhhhhhhhhhhhhh.........hhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...ee..ee...eee..eee.....eeeehhhhh...............hhhhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhh..eee....ee........eee.eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h1z A   7 VIDRFDVSRPELYRDDLWQAPFRELRATAPVHRVEHSDFGPYWSVSSYKPIITVESLPDLYSSAGGITLADFIENNPTDVRMPMFIAMDRPKHTGQRRTVAPAFTPSEMVRMSDNIRMRTAEVLDSLEWNTPFDWVDTVSVELTTQMLAILFDFPWEERRKLTFWSDWAGDIELVKNEELRLERLRHMYECGGYFQNLWNAKIGKPPTPDLISMMIHSDAMAEMDQMEFLGNLILLIVGGNDTTRNTMSAVAYGLDLFPDQRAKLEADPSMIPNTVQEIIRWQTPLAHMRRTATVDSELEGQQIKAGDKLALWYISANRDESVFENADRIIVDRPNARRHLAFGHGIHRCVGARLAELQIAVLLEEMAKRRMRVNVLGEPERVAACFVHGYRKLPVEISR 406
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5H1Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5H1Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5H1Z)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5H1Z)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    D12  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    His A:42 - Ser A:43   [ RasMol ]  
    Phe A:160 - Pro A:161   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5h1z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A1S4NYE0_9 | A0A1S4NYE0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A1S4NYE0_9 | A0A1S4NYE0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5H1Z)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5H1Z)