Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF FABK (M276A) MUTANT FROM THERMOTOGA MARITIMA
 
Authors :  E. E. Kim, S. C. Shin, B. H. Ha, J. H. Moon
Date :  06 Sep 16  (Deposition) - 26 Apr 17  (Release) - 26 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  B  (2x)
Keywords :  Fabk, Enoyl-Acp Reductase Ii, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. H. Ha, S. C. Shin, J. H. Moon, G. Keum, C. W. Kim, E. E. Kim
Structural And Biochemical Characterization Of Fabk From Thermotoga Maritima.
Biochem. Biophys. Res. V. 482 968 2017 Commun.
PubMed-ID: 27908729  |  Reference-DOI: 10.1016/J.BBRC.2016.11.141

(-) Compounds

Molecule 1 - ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [FMN]
    ChainsA, B
    EC Number1.3.1.9
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneTM_0800, TMARI_0801
    MutationYES
    Organism ScientificTHERMOTOGA MARITIMA (STRAIN ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
    Organism Taxid243274
    StrainATCC 43589 / MSB8 / DSM 3109 / JCM 10099
    SynonymUNCHARACTERIZED PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)A 
Biological Unit 2 (2x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1NA2Ligand/IonSODIUM ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:212 , VAL A:213 , ALA A:215 , ALA A:281 , ILE A:284 , HOH A:523binding site for residue NA A 401
2AC2SOFTWAREILE B:212 , VAL B:213 , ALA B:215 , ALA B:281 , ILE B:284 , HOH B:560binding site for residue NA B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GVJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5GVJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GVJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GVJ)

(-) Exons   (0, 0)

(no "Exon" information available for 5GVJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:294
                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhh....ee........hhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhh...eeeee...hhhhhhhhhhh..eeeeee.hhhhhhhhhhh....eeee.....ee....hhhhhhhhhhhhh...eeee....hhhhhhhhhhhh..eeehhhhhhh......hhhhhhhhhhh....eeee...eeee.hhhhhhhh..hhhhhhhh...........hhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5gvj A   2 TVRTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSVNIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGHPARVLRTPFARKIQLVGSLRRAVVEGDLERGSFAVGQSAGLIDEIKPVKQIIEDILKEFKETVEKLRGYI 312
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221  ||   235       258       268       278       288       298       308    
                                                                                                                                                                                                                                                        224|           243|                                                       
                                                                                                                                                                                                                                                         229            257                                                       

Chain B from PDB  Type:PROTEIN  Length:297
                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh....ee........hhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhh...eeeee...hhhhhhhhhhh..eeeeee.hhhhhhhhhhh....eeee.....ee....hhhhhhhhhhhhh...eeee....hhhhhhhhhhh...eeehhhhhhh......hhhhhhhhhhh....eeee....eeee.hhhhhhhhh....hhhhhhhh...........hhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gvj B   3 VRTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSVNIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAHPARVLRTPFARKIQEEMLVGSLRRAVVEGDLERGSFAVGQSAGLIDEIKPVKQIIEDILKEFKETVEKLRGYI 312
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222  ||   235       255       265       275       285       295       305       
                                                                                                                                                                                                                                                        225|            244|                                                         
                                                                                                                                                                                                                                                         229             255                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GVJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GVJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GVJ)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5gvj)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gvj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9WZQ7_THEMA | Q9WZQ7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.3.1.9
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9WZQ7_THEMA | Q9WZQ7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q9WZQ7_THEMA | Q9WZQ75gvh
UniProtKB/TrEMBL
        Q9WZQ7_THEMA | Q9WZQ73bo9

(-) Related Entries Specified in the PDB File

5gvh