Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CHOLERA TOXIN EL TOR B-PENTAMER IN COMPLEX WITH LEWIS-Y
 
Authors :  J. E. Heggelund, D. Burschowsky, U. Krengel
Date :  04 Nov 15  (Deposition) - 30 Mar 16  (Release) - 27 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J
Biol. Unit 1:  A,B,C,D,E  (1x)
Biol. Unit 2:  F,G,H,I,J  (1x)
Keywords :  Cholera Toxin B-Pentamer, Lewis-Y, Complex, Blood Group Oligosaccharide/Antigen, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. E. Heggelund, D. Burschowsky, V. A. Bjrnestad, V. Hodnik, G. Anderluh, U. Krengel
High-Resolution Crystal Structures Elucidate The Molecular Basis Of Cholera Blood Group Dependence.
Plos Pathog. V. 12 05567 2016
PubMed-ID: 27082955  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1005567

(-) Compounds

Molecule 1 - CHOLERA ENTEROTOXIN SUBUNIT B
    Chains: A, B, C, D, E, F, G, H, I, J
    Engineered: YES
    Expression System: VIBRIO
    Expression System Strain: SP. 60
    Expression System Taxid: 662
    Gene: CTXB, TOXB, VC_1456
    Organism Scientific: VIBRIO CHOLERAE SEROTYPE O1 (STRAIN ATCC 39315 / EL TOR INABA N16961)
    Organism Taxid: 243277
    Synonym: CHOLERA ENTEROTOXIN B CHAIN,CHOLERA ENTEROTOXIN GAMMA CHAIN, CHOLERAGENOID

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric Unit : ABCDEFGHIJ
Biological Unit 1 (1x): ABCDE     
Biological Unit 2 (1x):      FGHIJ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 60)

Asymmetric Unit (6, 60)
No.NameCountTypeFull Name
1BCN10Ligand/IonBICINE
2CA10Ligand/IonCALCIUM ION
3FUC19Ligand/IonALPHA-L-FUCOSE
4GAL9Ligand/IonBETA-D-GALACTOSE
5NAG5Ligand/IonN-ACETYL-D-GLUCOSAMINE
6NDG7Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
Biological Unit 1 (5, 32)
No.NameCountTypeFull Name
1BCN10Ligand/IonBICINE
2CA-1Ligand/IonCALCIUM ION
3FUC10Ligand/IonALPHA-L-FUCOSE
4GAL5Ligand/IonBETA-D-GALACTOSE
5NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
6NDG4Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
Biological Unit 2 (4, 18)
No.NameCountTypeFull Name
1BCN-1Ligand/IonBICINE
2CA-1Ligand/IonCALCIUM ION
3FUC9Ligand/IonALPHA-L-FUCOSE
4GAL4Ligand/IonBETA-D-GALACTOSE
5NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
6NDG3Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE

(-) Sites  (30, 30)

Asymmetric Unit (30, 30)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:79 , BCN A:204 , GLU F:79 , ASN J:103binding site for residue CA A 201
02AC2SOFTWARETYR A:76 , LEU A:77 , GLU A:79 , CA A:203 , HOH A:304 , ALA E:80 , LYS E:81 , ASN E:103 , GLU F:79binding site for residue BCN A 202
03AC3SOFTWAREGLU A:79 , BCN A:202 , GLU F:79 , HOH F:332binding site for residue CA A 203
04AC4SOFTWARELYS A:23 , GLU A:79 , CA A:201 , TYR F:76 , LEU F:77 , GLU F:79 , ALA J:80 , LYS J:81 , ASN J:103 , HOH J:312binding site for residue BCN A 204
05AC5SOFTWAREALA A:80 , LYS A:81 , ASN A:103 , TYR B:76 , LEU B:77 , GLU B:79 , BCN B:203 , CA B:204 , HOH B:304 , HOH B:314 , GLU J:79 , HOH J:301binding site for residue BCN B 201
06AC6SOFTWAREGLU B:79 , BCN B:203 , HOH B:312 , GLU J:79binding site for residue CA B 202
07AC7SOFTWAREGLU B:79 , BCN B:201 , CA B:202 , HOH B:312 , HOH B:319 , ALA I:80 , LYS I:81 , ASN I:103 , TYR J:76 , LEU J:77 , GLU J:79 , HOH J:321binding site for residue BCN B 203
08AC8SOFTWAREGLU B:79 , BCN B:201 , GLU J:79 , HOH J:301binding site for residue CA B 204
09AC9SOFTWAREGLU C:79 , BCN C:202 , HOH C:355 , GLU I:79binding site for residue CA C 201
10AD1SOFTWARELYS C:23 , GLU C:79 , CA C:201 , HOH C:331 , HOH C:355 , ALA H:80 , LYS H:81 , ASN H:103 , TYR I:76 , LEU I:77 , GLU I:79 , HOH I:308binding site for residue BCN C 202
11AD2SOFTWAREGLU C:79 , BCN C:204 , HOH C:339 , GLU I:79binding site for residue CA C 203
12AD3SOFTWAREALA B:80 , LYS B:81 , TYR C:76 , LEU C:77 , GLU C:79 , CA C:203 , HOH C:301 , HOH C:315 , HOH C:339 , LYS I:23 , GLU I:79binding site for residue BCN C 204
13AD4SOFTWAREALA C:80 , LYS C:81 , ASN C:103 , LYS D:23 , TYR D:76 , LEU D:77 , GLU D:79 , BCN D:203 , CA D:204 , HOH D:305 , GLU H:79 , HOH H:303binding site for residue BCN D 201
14AD5SOFTWAREGLU D:79 , BCN D:203 , HOH D:355 , GLU H:79binding site for residue CA D 202
15AD6SOFTWAREGLU D:79 , BCN D:201 , CA D:202 , HOH D:355 , ALA G:80 , LYS G:81 , ASN G:103 , TYR H:76 , LEU H:77 , GLU H:79 , HOH H:304binding site for residue BCN D 203
16AD7SOFTWAREGLU D:79 , BCN D:201 , GLU H:79 , HOH H:303binding site for residue CA D 204
17AD8SOFTWAREGLU E:79 , BCN E:204 , HOH E:359 , GLU G:79binding site for residue CA E 201
18AD9SOFTWAREALA D:80 , LYS D:81 , TYR E:76 , LEU E:77 , GLU E:79 , CA E:203 , HOH E:303 , HOH E:327 , GLU G:79binding site for residue BCN E 202
19AE1SOFTWAREGLU E:79 , BCN E:202 , HOH E:357 , GLU G:79binding site for residue CA E 203
20AE2SOFTWAREGLU E:79 , CA E:201 , HOH E:346 , ALA F:80 , LYS F:81 , TYR G:76 , LEU G:77 , GLU G:79 , HOH G:306binding site for residue BCN E 204
21AE3SOFTWARETYR F:18 , ALA F:46 , ILE F:47 , THR F:92 , PRO F:93 , HIS F:94 , HOH F:333 , GLN J:3binding site for residue FUC F 201
22AE4SOFTWAREGLN A:16 , TYR A:18 , GLY A:45 , ALA A:46 , ILE A:47 , PHE A:48 , PRO A:93 , HIS A:94 , HOH A:306 , HOH A:310 , GLN E:3binding site for Poly-Saccharide residues GAL A 205 through FUC A 208
23AE5SOFTWAREGLN A:3 , GLN A:16 , TYR A:18 , GLY A:45 , ALA A:46 , ILE A:47 , PHE A:48 , PRO A:93 , HIS A:94 , HOH A:306 , HOH A:310 , HOH A:343 , TYR B:18 , ASN B:44 , GLY B:45 , ALA B:46 , ILE B:47 , PHE B:48 , PRO B:93 , HIS B:94 , HOH B:301 , HOH B:302 , HOH B:323 , HOH B:338 , HOH B:351 , HOH B:356 , HOH B:362 , GLN E:3 , ASN E:90 , LYS E:91 , THR E:92 , HOH E:301binding site for Poly-Saccharide residues GAL B 205 through FUC B 208
24AE6SOFTWAREGLN A:3 , HOH A:343 , GLN B:3 , TYR B:18 , ASN B:44 , GLY B:45 , ALA B:46 , ILE B:47 , PHE B:48 , PRO B:93 , HIS B:94 , HOH B:301 , HOH B:302 , HOH B:323 , HOH B:338 , HOH B:351 , HOH B:356 , HOH B:362 , TYR C:18 , ASN C:44 , GLY C:45 , ALA C:46 , ILE C:47 , PHE C:48 , THR C:92 , PRO C:93 , HIS C:94 , HOH C:303 , HOH C:307 , HOH C:311 , HOH C:312 , HOH C:321 , HOH C:328 , HOH C:345 , HOH C:349 , ASN E:90 , LYS E:91 , THR E:92 , HOH E:301binding site for Poly-Saccharide residues GAL C 205 through FUC C 208
25AE7SOFTWAREGLN B:3 , GLN C:3 , TYR C:18 , ASN C:44 , GLY C:45 , ALA C:46 , ILE C:47 , PHE C:48 , THR C:92 , PRO C:93 , HIS C:94 , HOH C:303 , HOH C:307 , HOH C:311 , HOH C:312 , HOH C:321 , HOH C:328 , HOH C:345 , HOH C:349 , TYR D:18 , ASN D:44 , GLY D:45 , ALA D:46 , ILE D:47 , PRO D:93 , HIS D:94 , HOH D:310 , HOH D:328 , HOH D:345binding site for Poly-Saccharide residues GAL D 205 through FUC D 208
26AE8SOFTWAREGLN C:3 , GLN D:3 , TYR D:18 , ASN D:44 , GLY D:45 , ALA D:46 , ILE D:47 , PRO D:93 , HIS D:94 , HOH D:310 , HOH D:328 , HOH D:345 , TYR E:18 , ASN E:44 , GLY E:45 , ALA E:46 , ILE E:47 , PRO E:93 , HIS E:94 , HOH E:309 , HOH E:335 , THR I:19 , LYS I:84binding site for Poly-Saccharide residues GAL E 205 through FUC E 208
27AE9SOFTWAREGLN D:3 , ALA D:80 , LYS D:81 , TYR E:18 , ASN E:44 , GLY E:45 , ALA E:46 , ILE E:47 , TYR E:76 , LEU E:77 , GLU E:79 , PRO E:93 , HIS E:94 , HOH E:303 , HOH E:309 , HOH E:327 , HOH E:335 , HOH E:346 , HOH E:357 , HOH E:359 , GLN F:3 , ALA F:80 , LYS F:81 , GLN G:16 , TYR G:18 , ASN G:44 , GLY G:45 , ALA G:46 , ILE G:47 , PHE G:48 , TYR G:76 , LEU G:77 , GLU G:79 , THR G:92 , PRO G:93 , HIS G:94 , HOH G:303 , HOH G:306 , HOH G:316 , HOH G:336 , HOH G:345 , THR I:19 , LYS I:84 , ASN I:90binding site for Poly-Saccharide residues GAL G 201 through FUC G 204
28AF1SOFTWAREGLN F:3 , GLN G:3 , GLN G:16 , TYR G:18 , ASN G:44 , GLY G:45 , ALA G:46 , ILE G:47 , PHE G:48 , THR G:92 , PRO G:93 , HIS G:94 , HOH G:303 , HOH G:316 , HOH G:336 , HOH G:345 , TYR H:18 , ASN H:44 , GLY H:45 , ALA H:46 , ILE H:47 , PRO H:93 , HIS H:94 , HOH H:327 , ASN I:90binding site for Poly-Saccharide residues GAL H 201 through FUC H 204
29AF2SOFTWARELYS D:84 , HOH D:302 , GLN G:3 , GLN H:3 , TYR H:18 , ASN H:44 , GLY H:45 , ALA H:46 , ILE H:47 , PRO H:93 , HIS H:94 , HOH H:327 , TYR I:18 , ASN I:44 , GLY I:45 , ALA I:46 , ILE I:47 , PHE I:48 , PRO I:93 , HIS I:94 , HOH I:302 , HOH I:311 , HOH I:318 , HOH I:325 , HOH I:328 , HOH I:342 , HOH I:349 , HOH I:363binding site for Poly-Saccharide residues GAL I 201 through FUC I 204
30AF3SOFTWARELYS D:84 , HOH D:302 , GLN H:3 , GLN I:3 , TYR I:18 , ASN I:44 , GLY I:45 , ALA I:46 , ILE I:47 , PHE I:48 , PRO I:93 , HIS I:94 , HOH I:302 , HOH I:311 , HOH I:318 , HOH I:325 , HOH I:328 , HOH I:342 , HOH I:349 , HOH I:363 , TYR J:18 , ASN J:44 , GLY J:45 , ALA J:46 , ILE J:47 , THR J:92 , PRO J:93 , HIS J:94 , HOH J:306 , HOH J:351binding site for Poly-Saccharide residues GAL J 201 through FUC J 204

(-) SS Bonds  (10, 10)

Asymmetric Unit
No.Residues
1A:9 -A:86
2B:9 -B:86
3C:9 -C:86
4D:9 -D:86
5E:9 -E:86
6F:9 -F:86
7G:9 -G:86
8H:9 -H:86
9I:9 -I:86
10J:9 -J:86

(-) Cis Peptide Bonds  (10, 10)

Asymmetric Unit
No.Residues
1Thr A:92 -Pro A:93
2Thr B:92 -Pro B:93
3Thr C:92 -Pro C:93
4Thr D:92 -Pro D:93
5Thr E:92 -Pro E:93
6Thr F:92 -Pro F:93
7Thr G:92 -Pro G:93
8Thr H:92 -Pro H:93
9Thr I:92 -Pro I:93
10Thr J:92 -Pro J:93

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5ELC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5ELC)

(-) Exons   (0, 0)

(no "Exon" information available for 5ELC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh...eeeeeeeee..eeeee.......eeee.....eeee.......hhhhhhhhhhhhhhhhhhhhh..eeeeeeee.....eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc A   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain B from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..............................................hhhhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc B   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain C from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc C   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain D from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc D   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain E from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhhh..............eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc E   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain F from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh....eeeeeeeee..eeeee......eeeee.....eeee.........hhhhhhhhhhhhhhhhhhh..eeeeeeee.....eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc F   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain G from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh...............................................hhhhhhhhhhhhhhhhhhhhh......................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc G   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain H from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh...............................................hhhhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc H   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain I from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh...............................................hhhhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc I   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain J from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh...............................................hhhhhhhhhhhhhhhhhhhhhh..............eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elc J   1 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5ELC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5ELC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5ELC)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BCN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:92 - Pro A:93   [ RasMol ]  
    Thr B:92 - Pro B:93   [ RasMol ]  
    Thr C:92 - Pro C:93   [ RasMol ]  
    Thr D:92 - Pro D:93   [ RasMol ]  
    Thr E:92 - Pro E:93   [ RasMol ]  
    Thr F:92 - Pro F:93   [ RasMol ]  
    Thr G:92 - Pro G:93   [ RasMol ]  
    Thr H:92 - Pro H:93   [ RasMol ]  
    Thr I:92 - Pro I:93   [ RasMol ]  
    Thr J:92 - Pro J:93   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5elc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CHTB_VIBCH | P01556
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CHTB_VIBCH | P01556
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CHTB_VIBCH | P01556: 1chp 1chq 1ct1 1fgb 1g8z 1jr0 1md2 1rcv 1rd9 1rdp 1rf2 1s5b 1s5c 1s5d 1s5e 1s5f 1xtc 2chb 3chb 3efx 5ele 5elf 5lzg 5lzj

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5ELC)