5DCL - JenaLib

Title :   STRUCTURE OF A LANTIBIOTIC RESPONSE REGULATOR: N TERMINAL DOMAIN OF THE NISIN RESISTANCE REGULATOR NSRR

Authors :   S. Khosa, D. Kleinschrodt, A. Hoeppner, S. H. Smits

Date :   24 Aug 15 (Deposition) - 16 Mar 16 (Release) - 16 Mar 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.41

Chains :   Asym./Biol. Unit : A,B

Keywords :   Antimicrobial Peptide, Lantibiotic, Nisin, Resistance, Regulation, Two Component System, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Khosa, A. Hoeppner, H. Gohlke, L. Schmitt, S. H. Smits
Structure Of The Response Regulator Nsrr From Streptococcus Agalactiae, Which Is Involved In Lantibiotic Resistance.
Plos One V. 11 49903 2016
PubMed-ID: 26930060 | Reference-DOI: 10.1371/JOURNAL.PONE.0149903

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 39)

Sites (39, 39)

Asymmetric Unit (39, 39)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	LYS A:41 , TYR A:65 , GLU A:69	binding site for residue EDO A 301
02	AC2	SOFTWARE	ASP A:13 , PRO A:59 , TYR A:60 , PHE A:61	binding site for residue EDO A 302
03	AC3	SOFTWARE	LYS A:22 , SER A:32 , SER A:33 , SER A:35 , EDO A:304 , EDO B:309	binding site for residue EDO A 303
04	AC4	SOFTWARE	SER A:32 , SER A:33 , SER A:35 , GLU A:43 , PHE A:47 , EDO A:303 , SER B:107 , EDO B:309	binding site for residue EDO A 304
05	AC5	SOFTWARE	LYS A:41 , ILE A:45 , PHE A:73 , LEU A:74 , EDO A:312 , HOH A:401 , LYS B:72	binding site for residue EDO A 305
06	AC6	SOFTWARE	ILE A:44 , GLN A:48 , PRO A:49 , ILE A:76 , EDO A:312	binding site for residue EDO A 306
07	AC7	SOFTWARE	GLU A:12 , MET A:15 , SER A:33 , VAL A:34 , EDO A:308	binding site for residue EDO A 307
08	AC8	SOFTWARE	VAL A:34 , SER A:35 , PHE A:37 , EDO A:307 , PRO B:105	binding site for residue EDO A 308
09	AC9	SOFTWARE	THR A:57 , SER A:83 , LYS A:104 , EDO A:313 , EDO B:313 , HOH B:440	binding site for residue EDO A 309
10	AD1	SOFTWARE	ILE A:56 , THR A:57 , PHE A:64 , HOH A:423 , TYR B:65 , EDO B:313	binding site for residue EDO A 310
11	AD2	SOFTWARE	LEU A:20 , PRO A:105 , PHE A:106	binding site for residue EDO A 311
12	AD3	SOFTWARE	ILE A:45 , GLN A:48 , EDO A:305 , EDO A:306 , HOH A:401 , LYS B:72	binding site for residue EDO A 312
13	AD4	SOFTWARE	ASP A:14 , LYS A:104 , EDO A:309 , HOH A:418	binding site for residue EDO A 313
14	AD5	SOFTWARE	ASP A:99 , ALA A:117	binding site for residue EDO A 314
15	AD6	SOFTWARE	LYS A:72 , PHE A:73 , THR A:75	binding site for residue EDO A 315
16	AD7	SOFTWARE	LYS A:72 , HOH A:403	binding site for residue EDO A 316
17	AD8	SOFTWARE	GLN A:5 , SER A:26 , TYR A:29 , HIS A:30	binding site for residue EDO A 317
18	AD9	SOFTWARE	ASP A:89 , MET A:90 , PHE A:101 , VAL A:110	binding site for residue EDO A 318
19	AE1	SOFTWARE	SER B:28 , TYR B:29 , ASP B:112 , HOH B:405	binding site for residue EDO B 301
20	AE2	SOFTWARE	ILE B:45 , ASP B:89 , MET B:90 , PHE B:101 , EDO B:311 , HOH B:448	binding site for residue EDO B 302
21	AE3	SOFTWARE	ARG B:38 , LYS B:41 , GLN B:42 , TRP B:66 , HOH B:407	binding site for residue EDO B 303
22	AE4	SOFTWARE	GLU B:12 , ASP B:13 , ASP B:55 , THR B:57 , LEU B:58 , LYS B:104 , HOH B:466	binding site for residue EDO B 304
23	AE5	SOFTWARE	LYS B:22 , SER B:32 , SER B:33 , VAL B:34 , HOH B:461	binding site for residue EDO B 305
24	AE6	SOFTWARE	ASP B:13 , ASP B:14 , MET B:15	binding site for residue EDO B 306
25	AE7	SOFTWARE	ASP B:13 , LEU B:58 , PRO B:59 , TYR B:60 , PHE B:61 , HOH B:409 , HOH B:453	binding site for residue EDO B 307
26	AE8	SOFTWARE	GLU A:4 , GLU B:4 , LYS B:22 , SER B:26 , TYR B:29 , HIS B:30 , VAL B:31	binding site for residue EDO B 308
27	AE9	SOFTWARE	EDO A:303 , EDO A:304 , SER B:107 , LEU B:108 , ALA B:109 , EDO B:317	binding site for residue EDO B 309
28	AF1	SOFTWARE	LYS B:41 , TYR B:65 , TRP B:66 , GLU B:69 , ALA B:117 , HOH B:431	binding site for residue EDO B 310
29	AF2	SOFTWARE	GLN A:42 , MET B:90 , ASP B:100 , PHE B:101 , LYS B:114 , EDO B:302 , EDO B:318 , HOH B:457	binding site for residue EDO B 311
30	AF3	SOFTWARE	ARG B:71 , HOH B:401	binding site for residue EDO B 312
31	AF4	SOFTWARE	SER A:83 , EDO A:309 , EDO A:310 , ALA B:68 , GLU B:69	binding site for residue EDO B 313
32	AF5	SOFTWARE	ARG B:38 , THR B:75 , PRO B:77 , EDO B:321 , HOH B:402 , HOH B:426	binding site for residue EDO B 314
33	AF6	SOFTWARE	ALA B:46 , VAL B:91 , ASN B:95	binding site for residue EDO B 315
34	AF7	SOFTWARE	PRO B:105 , PHE B:106	binding site for residue EDO B 316
35	AF8	SOFTWARE	HIS B:24 , ALA B:109 , ASP B:112 , EDO B:309 , HOH B:410	binding site for residue EDO B 317
36	AF9	SOFTWARE	ASN A:36 , ARG A:38 , SER B:103 , EDO B:311 , HOH B:404	binding site for residue EDO B 318
37	AG1	SOFTWARE	VAL B:34 , SER B:35 , PHE B:37	binding site for residue EDO B 319
38	AG2	SOFTWARE	GLN A:42 , ILE A:45 , LYS B:41 , LYS B:114	binding site for residue EDO B 320
39	AG3	SOFTWARE	ASN B:85 , EDO B:314	binding site for residue EDO B 321

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:117
                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhh...eeee.....hhhhhhhhhh..eeeee......hhhhhhhhhh......eeeeee.hhh.hhhhhhhh...eeeee..hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------- Transcript
                 5dcl A   4 EQGKIYIVEDDMTIVSLLKDHLSASYHVSSVSNFRDVKQEIIAFQPDLILMDITLPYFNGFYWTAELRKFLTIPIIFISSSNDEMDMVMALNMGGDDFISKPFSLAVLDAKLTAILR 120
                                    13        23        33        43        53        63        73        83        93       103       113

Chain B from PDB  Type:PROTEIN  Length:117
                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhh..eeeee.....hhhhhhhhhh..eeeee......hhhhhhhhhh......eeeeee.....hhhhhhhh...eeeee..hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------- Transcript
                 5dcl B   4 EQGKIYIVEDDMTIVSLLKDHLSASYHVSSVSNFRDVKQEIIAFQPDLILMDITLPYFNGFYWTAELRKFLTIPIIFISSSNDEMDMVMALNMGGDDFISKPFSLAVLDAKLTAILR 120
                                    13        23        33        43        53        63        73        83        93       103       113

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]
		AF2	[ RasMol ]	+environment [ RasMol ]
		AF3	[ RasMol ]	+environment [ RasMol ]
		AF4	[ RasMol ]	+environment [ RasMol ]
		AF5	[ RasMol ]	+environment [ RasMol ]
		AF6	[ RasMol ]	+environment [ RasMol ]
		AF7	[ RasMol ]	+environment [ RasMol ]
		AF8	[ RasMol ]	+environment [ RasMol ]
		AF9	[ RasMol ]	+environment [ RasMol ]
		AG1	[ RasMol ]	+environment [ RasMol ]
		AG2	[ RasMol ]	+environment [ RasMol ]
		AG3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Lys A:104 - Pro A:105	[ RasMol ]
		Lys B:104 - Pro B:105	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5dcl
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	X5JZS1_STRAG \| X5JZS1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description