Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  REACTION OF PHOSPHORYLATED CHEY WITH IMIDAZOLE 1 OF 3
 
Authors :  S. Page, R. E. Silversmith, R. B. Bourret, E. J. Collins
Date :  05 Aug 15  (Deposition) - 09 Mar 16  (Release) - 09 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.06
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Two Component Signaling, Asp To His Phosphotransfer, Response Regulator, Receiver Domain, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. C. Page, R. E. Silversmith, E. J. Collins, R. B. Bourret
Imidazole As A Small Molecule Analogue In Two-Component Signal Transduction.
Biochemistry V. 54 7248 2015
PubMed-ID: 26569142  |  Reference-DOI: 10.1021/ACS.BIOCHEM.5B01082

(-) Compounds

Molecule 1 - CHEMOTAXIS PROTEIN CHEY
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: CHEY, Z2936, ECS2592
    Mutation: YES
    Organism Taxid: 83334

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 15)

Asymmetric Unit (5, 15)
No.NameCountTypeFull Name
1BEF2Ligand/IonBERYLLIUM TRIFLUORIDE ION
2GOL5Ligand/IonGLYCEROL
3IMD5Ligand/IonIMIDAZOLE
4MN2Ligand/IonMANGANESE (II) ION
5SO41Ligand/IonSULFATE ION
Biological Unit 1 (4, 7)
No.NameCountTypeFull Name
1BEF1Ligand/IonBERYLLIUM TRIFLUORIDE ION
2GOL3Ligand/IonGLYCEROL
3IMD2Ligand/IonIMIDAZOLE
4MN-1Ligand/IonMANGANESE (II) ION
5SO41Ligand/IonSULFATE ION
Biological Unit 2 (3, 6)
No.NameCountTypeFull Name
1BEF1Ligand/IonBERYLLIUM TRIFLUORIDE ION
2GOL2Ligand/IonGLYCEROL
3IMD3Ligand/IonIMIDAZOLE
4MN-1Ligand/IonMANGANESE (II) ION
5SO4-1Ligand/IonSULFATE ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:13 , ASP A:57 , LYS A:59 , BEF A:202 , IMD A:203 , HOH A:302binding site for residue MN A 201
02AC2SOFTWAREASP A:57 , TRP A:58 , LYS A:59 , THR A:87 , ALA A:88 , LYS A:109 , MN A:201 , IMD A:203 , IMD A:204binding site for residue BEF A 202
03AC3SOFTWAREASP A:13 , GLN A:14 , LYS A:59 , MN A:201 , BEF A:202 , IMD A:204binding site for residue IMD A 203
04AC4SOFTWAREALA A:88 , TYR A:89 , BEF A:202 , IMD A:203binding site for residue IMD A 204
05AC5SOFTWAREARG A:19 , LYS A:70 , HOH A:315 , LYS B:126binding site for residue GOL A 205
06AC6SOFTWARELYS A:92 , HOH A:371 , HOH A:372 , LYS B:91 , LYS B:92 , HOH B:329binding site for residue SO4 A 206
07AC7SOFTWARELYS A:91 , LYS A:92 , GLU A:93 , HOH A:359binding site for residue GOL A 207
08AC8SOFTWARELEU A:46 , GLY A:49 , GLY A:50 , TYR A:51 , ALA A:77 , MET A:78 , HOH A:382binding site for residue GOL A 208
09AC9SOFTWAREASP B:13 , ASP B:57 , LYS B:59 , BEF B:202 , IMD B:203 , HOH B:306binding site for residue MN B 201
10AD1SOFTWAREASP B:57 , TRP B:58 , LYS B:59 , THR B:87 , ALA B:88 , LYS B:109 , MN B:201 , IMD B:203 , IMD B:204 , HOH B:306 , HOH B:386binding site for residue BEF B 202
11AD2SOFTWAREASP B:13 , LYS B:59 , MN B:201 , BEF B:202 , IMD B:204binding site for residue IMD B 203
12AD3SOFTWAREALA B:88 , TYR B:89 , BEF B:202 , IMD B:203 , HOH B:386binding site for residue IMD B 204
13AD4SOFTWAREARG B:19 , LYS B:70 , HOH B:307 , HOH B:367binding site for residue GOL B 205
14AD5SOFTWARESER B:15 , ARG B:18 , ARG B:19 , GLU B:35 , HOH B:303 , HOH B:336 , HOH B:351binding site for residue GOL B 206
15AD6SOFTWARELEU B:46 , GLY B:49 , GLY B:50 , TYR B:51binding site for residue IMD B 207

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D2C)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Lys A:109 -Pro A:110
2Lys B:109 -Pro B:110

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D2C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D2C)

(-) Exons   (0, 0)

(no "Exon" information available for 5D2C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee..hhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhh....eeee.......hhhhhhhhhhhh.......eeeee...hhhhhhhhhhh...eeee...hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d2c A   2 ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
                                    11        21        31        41        51        61        71        81        91       101       111       121        


Chain B from PDB  Type:PROTEIN  Length:128
                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee..hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhh....eeee.......hhhhhhhhhhhh.......eeeee...hhhhhhhhhhh...eeee...hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d2c B   2 ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
                                    11        21        31        41        51        61        71        81        91       101       111       121
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D2C)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D2C)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D2C)

(-) Gene Ontology  (12, 17)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BEF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys A:109 - Pro A:110   [ RasMol ]  
    Lys B:109 - Pro B:110   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d2c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CHEY_ECO57 | P0AE68
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CHEY_ECOLI | P0AE67
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CHEY_ECO57 | P0AE68
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CHEY_ECOLI | P0AE67
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CHEY_ECO57 | P0AE68: 1a0o 1ab5 1ab6 1bdj 1c4w 1cey 1chn 1cye 1d4z 1djm 1e6k 1e6l 1eay 1ehc 1f4v 1ffg 1ffs 1fqw 1hey 1jbe 1kmi 1mih 1u8t 1udr 1vlz 1ymu 1ymv 1zdm 3chy 5chy 5dgc 5dkf 6chy
        CHEY_ECOLI | P0AE67: 1a0o 1ab5 1ab6 1bdj 1c4w 1cey 1chn 1cye 1d4z 1djm 1e6k 1e6l 1e6m 1eay 1ehc 1f4v 1ffg 1ffs 1ffw 1fqw 1hey 1jbe 1kmi 1mih 1u8t 1udr 1vlz 1ymu 1ymv 1zdm 2b1j 2id7 2id9 2idm 2lp4 3chy 3f7n 3fft 3ffw 3ffx 3fgz 3myy 3olv 3olw 3olx 3oly 3oo0 3oo1 3rvj 3rvk 3rvl 3rvm 3rvn 3rvo 3rvp 3rvq 3rvr 3rvs 5chy 5dgc 5dkf 6chy

(-) Related Entries Specified in the PDB File

3ffw 3FFW CONTAINS SAME PROTEIN BUT WITHOUT IMIDAZOLE