Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  WILD-TYPE BACILLUS SUBTILIS LIPASE A WITH 20% [BMIM][CL]
 
Authors :  E. M. Nordwald, J. G. Plaks, J. R. Snell, M. C. Sousa, J. L. Kaar
Date :  23 Jul 15  (Deposition) - 04 Nov 15  (Release) - 03 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. M. Nordwald, J. G. Plaks, J. R. Snell, M. C. Sousa, J. L. Kaar
Crystallographic Investigation Of Imidazolium Ionic Liquid Effects On Enzyme Structure.
Chembiochem V. 16 2456 2015
PubMed-ID: 26388426  |  Reference-DOI: 10.1002/CBIC.201500398

(-) Compounds

Molecule 1 - LIPASE ESTA
    ChainsA, B
    EC Number3.1.1.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneESTA, LIP, LIPA, BSU02700
    Organism ScientificBACILLUS SUBTILIS (STRAIN 168)
    Organism Taxid224308
    Strain168
    SynonymLIPASE A,TRIACYLGLYCEROL LIPASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric Unit (2, 11)
No.NameCountTypeFull Name
1BM08Ligand/Ion1-BUTYL-3-METHYL-1H-IMIDAZOL-3-IUM
2CL3Ligand/IonCHLORIDE ION
Biological Unit 1 (1, 5)
No.NameCountTypeFull Name
1BM05Ligand/Ion1-BUTYL-3-METHYL-1H-IMIDAZOL-3-IUM
2CL-1Ligand/IonCHLORIDE ION
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1BM03Ligand/Ion1-BUTYL-3-METHYL-1H-IMIDAZOL-3-IUM
2CL-1Ligand/IonCHLORIDE ION
Biological Unit 3 (1, 8)
No.NameCountTypeFull Name
1BM08Ligand/Ion1-BUTYL-3-METHYL-1H-IMIDAZOL-3-IUM
2CL-1Ligand/IonCHLORIDE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:155 , HIS A:156 , ILE A:157 , GLY A:158 , GLY B:155binding site for residue CL A 201
02AC2SOFTWAREILE A:12 , GLY A:13 , GLY A:14 , ASN A:18 , SER A:77 , HIS A:156 , HOH A:305binding site for residue BM0 A 202
03AC3SOFTWARETYR A:49 , ASN A:50 , HOH A:302 , HIS B:3 , LYS B:35 , THR B:66 , GLY B:67 , ALA B:68 , MET B:137binding site for residue BM0 A 203
04AC4SOFTWARETHR A:45 , THR A:47 , HOH A:396 , LEU B:108binding site for residue BM0 A 204
05AC5SOFTWAREGLY A:116 , ASP A:118 , PRO A:119 , LYS A:122 , HOH A:375 , HOH B:348binding site for residue BM0 A 205
06AC6SOFTWAREASP A:34 , LEU A:36 , TYR A:37 , ARG A:107 , ARG A:142 , ASP A:144binding site for residue BM0 A 206
07AC7SOFTWAREGLY A:155 , HOH A:306 , HIS B:156 , ILE B:157binding site for residue CL B 201
08AC8SOFTWARETHR B:47 , ASN B:48 , HOH B:380binding site for residue CL B 202
09AC9SOFTWAREILE A:157 , TRP B:42 , GLY B:158 , TYR B:161 , HOH B:367binding site for residue BM0 B 203
10AD1SOFTWAREASP B:34 , LEU B:36 , TYR B:37 , ARG B:107 , ARG B:142 , ASP B:144 , HOH B:381binding site for residue BM0 B 204
11AD2SOFTWARETYR A:161 , PHE B:17 , TYR B:161binding site for residue BM0 B 205

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CT6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CT6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CT6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CT6)

(-) Exons   (0, 0)

(no "Exon" information available for 5CT6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhh..hhh.eee........hhhhhhhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhh.eeeeeee..hhhhh..............eeeeeee......hhhhhh....eeeee.....hhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ct6 A   3 HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN 181
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172         

Chain B from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhhhhh..hhh.eee........hhhhhhhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhh.eeeeeee..hhhhh..............eeeeeee......hhhhhh....eeeee....hhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ct6 B   3 HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN 181
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CT6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CT6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CT6)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BM0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ct6)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ct6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ESTA_BACSU | P37957
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ESTA_BACSU | P37957
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ESTA_BACSU | P379571i6w 1isp 1r4z 1r50 1t2n 1t4m 2qxt 2qxu 3d2a 3d2b 3d2c 3qmm 3qzu 5cri 5ct4 5ct5 5ct8 5ct9 5cta 5cur

(-) Related Entries Specified in the PDB File

5cri 5ct4 5ct5 5ct8 5ct9 5cta